(data stored in SCRATCH zone)

EMBL: CP000880.PE433

CP000880.PE433       Location/Qualifiers
FT   CDS_pept        456652..457518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2435 1.2e-144 pdxK;
FT                   pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine
FT                   kinase K00868; COG: COG2240
FT                   Pyridoxal/pyridoxine/pyridoxamine kinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20387"
FT                   /db_xref="GOA:A9MIF0"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF0"
FT                   /inference="protein motif:HMMPfam:IPR011611"
FT                   /inference="protein motif:HMMTigr:IPR004625"
FT                   /inference="similar to AA sequence:INSD:AAO68140.1"
FT                   /protein_id="ABX20387.1"
FT                   /translation="MGQESDIQSVLFDDNHRALQTDIVAVQSQVVYGSVGNSIAVPAIK
FT                   AQGLRVTAVPTVLFSNTPHYKTFYGGILPAEWFAGYLTALNERDALRELKAITTGYMGS
FT                   ADQIVLLSEWLMAVRASHPEVCILVDPVIGDTDSGMYVQAEIPQAYRTHLLPQAQGLTP
FT                   NVFELEILSGKPCRTQEEAVAAAQSLLSDTLKWVVITSAPGESLETITVAVVTAQAVEV
FT                   FDHPRVATELKGTGDLFCAELVCGIVQGKNLTNAARDAAQRVLEVMTWTQRCGCDELIL
FT                   PPAGEAR"
     atggggcaag agagtgatat tcagtcagtg ctctttgacg acaaccatcg ggcgttgcaa        60
     accgacattg tcgccgttca gtcacaggtc gtgtacggca gcgtcggcaa cagcattgcc       120
     gtaccggcga ttaaagcgca ggggctacgg gtgacggcag tcccgacggt gctgttcagc       180
     aataccccgc attataaaac gttttatggc ggcattcttc ctgccgaatg gtttgctggc       240
     taccttacgg cgctgaatga gcgcgatgcg ttacgcgaat taaaagcgat aaccacgggt       300
     tacatgggca gcgcagacca aattgtcttg ctctcagagt ggttaatggc tgtccgggct       360
     tcgcatccgg aggtctgtat tcttgtcgat ccggttattg gcgataccga cagcggaatg       420
     tatgtgcaag cggaaattcc tcaggcctat cgcacacatt tactgccgca ggcgcagggg       480
     ttaacgccaa acgtgttcga gctggagata ctgagtggta aaccatgccg cacgcaggaa       540
     gaggcggtgg cggcggcgca atcgctactt tccgatacgc tgaaatgggt agtcattacc       600
     agcgcgccgg gcgaatctct ggagacgata acggttgccg ttgttaccgc gcaggccgtg       660
     gaggtctttg atcatccacg ggtggcgacg gagttaaaag ggacgggcga tctcttctgc       720
     gccgagctgg tctgcggtat tgtgcagggc aaaaatctga cgaacgcggc aagagatgcc       780
     gcgcagcgcg tgctggaggt catgacctgg acacaacggt gtggctgtga tgagttaatt       840
     ctgccaccgg caggggaggc gcgatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page