(data stored in SCRATCH zone)

EMBL: CP000880.PE442

CP000880.PE442       Location/Qualifiers
FT   CDS_pept        462985..463965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2744 8.5e-135 zipA; cell division
FT                   protein ZipA K03528; COG: COG3115 Cell division protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20396"
FT                   /db_xref="GOA:A9MIF9"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MIF9"
FT                   /inference="protein motif:HMMPfam:IPR007449"
FT                   /inference="protein motif:HMMSmart:IPR007449"
FT                   /inference="protein motif:HMMTigr:IPR011919"
FT                   /inference="similar to AA sequence:INSD:AAV76448.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20396.1"
FT                   /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMK
FT                   SKRDDDSYDDDVDADEGVGEVRVHRVNHAPGQPQEHDAPRQSPQHQYQPPYASAQPRPA
FT                   TPPQPQAPQQQPVQQPPQPVPPPQQVQPSAPPVQPQQPAQPSQAPQPVAQPAPPLAEQT
FT                   FQPADPAVEAEPVVEEAPVVEKPQRKEVVIIMNVAAHHGSELNGEVLLNSIQQSGFKFG
FT                   DMNIFHRHLSPDGSGPALFSLANMVNPGTFDPEMTDFTTPGVTIFMQVPSYGDALQNFK
FT                   LMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDRIREVMDANA"
     atgatgcagg atttgcgtct gatattaatc attgttggcg cgatcgccat aatcgcttta        60
     ctggtacatg gtttctggac cagccgtaaa gaacgatctt ctatgttccg cgatcgtcca       120
     ctaaaacgca tgaaatcaaa acgcgacgac gactcgtatg acgacgatgt cgatgcagac       180
     gaaggcgtgg gtgaagttcg tgttcaccgc gtgaatcatg cccccggtca gccgcaggag       240
     catgatgccc ctcgccagtc gccgcaacac cagtaccagc cgccttatgc gtctgcgcaa       300
     ccgcgtccag cgacgccacc gcagccgcaa gcgccgcagc aacagccggt gcagcagccg       360
     ccccaacctg tgccgccgcc tcaacaggtt cagccatctg cgccgccggt acagccgcag       420
     cagcctgcac agccgtcgca agcgccgcag cctgttgcgc agcccgcacc gccgttagca       480
     gagcaaacct tccagcctgc ggatcctgcc gttgaggcgg aacctgtggt ggaagaagcg       540
     ccggttgtgg aaaaaccaca gcgtaaagag gtggttatca ttatgaacgt cgcggcccat       600
     catggtagcg agctcaatgg tgaagtgcta ctgaacagta ttcagcagtc aggctttaaa       660
     tttggcgata tgaacatctt ccatcgtcat ttgagcccgg acggtagcgg cccggctttg       720
     tttagtctcg cgaatatggt taatccggga acctttgatc ctgaaatgac ggacttcact       780
     acgcccggcg tcactatctt tatgcaggtg ccgtcttacg gcgatgcgct gcaaaacttt       840
     aagctgatgc tgcaatccgc gcagcatatc gctgatgagg tcggcggcgt agtgctggat       900
     gaccagcgtc ggatgatgac gccgcagaaa ctgcgtgaat atcaggatcg catccgcgag       960
     gtgatggacg ctaacgcctg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page