(data stored in SCRATCH zone)

EMBL: CP000880.PE453

CP000880.PE453       Location/Qualifiers
FT   CDS_pept        complement(477145..478143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02454 5.5e-108 probable
FT                   oxidoreductase protein K05882; COG: COG0667 Predicted
FT                   oxidoreductases (related to aryl-alcohol dehydrogenases);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20407"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH0"
FT                   /inference="protein motif:BlastProDom:IPR001395"
FT                   /inference="protein motif:Gene3D:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR005399"
FT                   /inference="protein motif:HMMPfam:IPR001395"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149771.1"
FT                   /protein_id="ABX20407.1"
FT                   /translation="MVYQPDENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDATRVENS
FT                   RALLQRAFDLGITHFDLANNYGPPPGSAECNFGRILQEDFLPWRDELVISTKAGYTMWD
FT                   GPYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDPETPLKETMKALDHLVRQGKAL
FT                   YVGISNYPADLARQAIDILEDLGTPCLIHQPKYSLFERWVEDGLLALLQEKGVGSIAFS
FT                   PLAGGQLTDRYLNGIPEDSRAASGSRFLKPEHITADKLEKVRQLNELAARRGQKLSQMA
FT                   LAWVLRNDNVTSVLIGASKPSQIEDAVGMLANRRFSATECAEIDAILDGRF"
     atggtttatc agcccgatga gaatcgttat cacacaatgg aatatcgccg ctgcgggcgc        60
     agtggcgtca aacttcccgc catttcgctg gggttatggc acaacttcgg cgatgcgaca       120
     cgggtagaaa acagccgggc gctgctgcaa cgcgcgttcg atctgggcat tacccacttt       180
     gatctcgcca ataattatgg gccgccgccg ggctccgcag aatgcaattt tggccgcatt       240
     ctgcaggagg attttttacc gtggcgtgat gagttggtca tctccaccaa agcgggctat       300
     accatgtggg atggccctta tggcgactgg gggtcacgta aataccttat cgccagcctc       360
     gatcaaagcc tgaaacgtat ggggctggag tatgtcgata tcttttatca ccatcgtccc       420
     gaccccgaaa caccgcttaa agagacgatg aaagcgttgg atcaccttgt gcgccagggc       480
     aaagcattgt acgtggggat ctctaactat cctgccgatc tggccagaca agctatcgat       540
     atcctggagg atctcggcac gccctgcctg attcatcaac caaaatattc gctttttgag       600
     cgttgggtgg aggacgggct actggcgctg ttgcaggaaa agggcgtcgg cagtattgcg       660
     ttttcgccgc tggcgggcgg gcagctcact gaccgttatc tgaatggtat cccggaagat       720
     tcccgcgcgg cgagcggaag ccgtttcctt aaaccagaac atattaccgc cgacaaactg       780
     gaaaaagtcc gccagttgaa tgaactggct gcgcggcggg gccaaaaact atcccagatg       840
     gcgctcgcct gggtgctgcg taacgataac gttacctcgg tgctgattgg cgccagcaaa       900
     ccgtcacaaa tcgaagatgc cgtgggaatg ctggcaaacc gccgtttttc agcgacggaa       960
     tgtgcagaaa ttgacgcgat tctggacggt cggttttag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page