(data stored in SCRATCH zone)

EMBL: CP000880.PE455

CP000880.PE455       Location/Qualifiers
FT   CDS_pept        complement(479995..481287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1400 1.4e-09 chloride channel protein
FT                   K01529; COG: COG0038 Chloride channel protein EriC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20409"
FT                   /db_xref="GOA:A9MIH2"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR022969"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH2"
FT                   /inference="protein motif:HMMPanther:IPR001807"
FT                   /inference="protein motif:HMMPfam:IPR001807"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149773.1"
FT                   /protein_id="ABX20409.1"
FT                   /translation="MPLGRLCKNRYTTPCKEEIMFHPRARAMLLLSIPALIIGVASSLV
FT                   LIAAMKVASIFQQFLWQRLPASIGIAYDSPFWIVGMLTLTGVVVGLIIRYSPGHAGPDP
FT                   AIEPLISMPVSPSALPGLLLALIIGLAGGVSLGPEHPIMTINIALAVAFGSRLFPRITT
FT                   LDWMILASAGTIGALFGTPVAAALIFSQTLSGSNDVPMWDRLFAPLMAAAAGSLTTSLF
FT                   FHPHFSLPIAHYTQMRLMDIASGAIVAAIAIAAGMVAVWCLPRLHELLHRLKNPVLILG
FT                   FGGFILGILGVIGGPLTLFKGLDEMQQMAFSQTLDAGDYFTLAIVKLTALVIAAASGFR
FT                   GGRIFPAVFIGAALGLMLHAHVETVPAAITVSCAILGLVLVVTRDGWLSLFMATVVVPD
FT                   TNLLPLLCIVMLPAWLLLAGKPLLAANRHEP"
     atgccgttgg gcaggctgtg caaaaatagg tatacgaccc cgtgtaagga agagattatg        60
     ttccacccgc gtgcccgagc gatgctgctg ctgtcgatcc ctgcactgat tattggcgta       120
     gcgtcaagcc tggttttaat cgccgcgatg aaagtcgcgt caatttttca gcaatttctt       180
     tggcaacggc tgcccgccag catcggaatc gcttatgatt caccgttctg gatagtaggt       240
     atgctcacgc taaccggtgt cgtggtaggt ttgattatcc gttacagccc tggacatgca       300
     ggccccgatc ccgccatcga gccgttaatc agtatgccgg tttcgccctc tgcactgcca       360
     ggactgcttc tcgccttaat catcggcctt gccggtggag taagtctggg gccggagcat       420
     ccgataatga caataaatat cgcgctggcg gtggctttcg gctctcgcct gtttccgcgt       480
     atcacgacgt tagactggat gattctggcc tcggcgggca ccatcggcgc gctgttcggc       540
     acgcccgtcg ctgcggcgct gattttttcg caaacgctta gcggttctaa cgatgtacct       600
     atgtgggatc gcctgtttgc gccgttaatg gcggcagcgg cggggtcgct aaccaccagc       660
     ctgttctttc atccgcattt ttcgttaccc atcgcccatt acacgcagat gcgactaatg       720
     gacattgcca gcggagcgat cgtcgcggcg atcgctattg ctgcaggaat ggtcgccgtc       780
     tggtgccttc cacgtctgca tgagttactg caccggctga aaaatccggt cctgattctc       840
     ggctttggcg gttttatact gggtatcctg ggcgtcattg gcgggccgct taccctgttt       900
     aaagggttgg acgaaatgca acaaatggcg tttagccaga cgctggacgc gggagattat       960
     tttaccctag ccatcgtcaa gctcaccgcg ctggtcatcg cggcggcgag cggctttcgc      1020
     ggcggacgca tttttccggc cgtatttatt ggcgcggcgc tgggactcat gctccatgcc      1080
     cacgttgaga ccgtaccggc agcgattacc gtctcctgcg caattcttgg cttagtgctg      1140
     gtggtgacgc gtgacggctg gctcagtctg tttatggcga cagtcgtcgt accagatacc      1200
     aatctgctgc cgctgctatg cattgtgatg ctcccggcct ggctattgct ggcgggaaaa      1260
     ccgttgctgg ccgccaaccg tcacgagccc taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page