(data stored in SCRATCH zone)

EMBL: CP000880.PE474

CP000880.PE474       Location/Qualifiers
FT   CDS_pept        complement(502087..502446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH3153 0.00026 cytochrome C oxidase heme
FT                   b and copper-binding subunit K00404; COG: COG0730 Predicted
FT                   permeases; Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20428"
FT                   /db_xref="GOA:A9MIJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIJ1"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:REFSEQ:YP_049191.1"
FT                   /protein_id="ABX20428.1"
FT                   /translation="MITIMSVFLLAGIVKGVVGLGLPTISMGLLTVVMAQASAASLLII
FT                   PSLATNIWQLFTGPAFLSLIKRLWGFIAGIFIGTLFSVLPGLTSTSSWTEAVPGIVLIM
FT                   YGLWGAYCHEVPVPG"
     gtgattacca ttatgtccgt attcctattg gccggaatag tgaaaggtgt ggtcgggctg        60
     gggctgccga cgatatccat gggtttatta accgtcgtta tggcgcaggc cagcgcagcc       120
     agtttgttga ttattccctc tctggcgacg aatatatggc aactctttac tggccctgca       180
     tttcttagtt taatcaaaag attatggggg tttatcgcag ggattttcat tggcacgtta       240
     ttcagcgtgt tacccggttt aacctctaca tcctcatgga ctgaagcggt gccaggtatc       300
     gtgcttatta tgtatggtct gtggggggct tattgccacg aagttcccgt ccccggatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page