(data stored in SCRATCH zone)

EMBL: CP000880.PE481

CP000880.PE481       Location/Qualifiers
FT   CDS_pept        509104..509346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00509"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3691 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20435"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ35"
FT                   /inference="protein motif:HMMPfam:IPR005272"
FT                   /inference="protein motif:HMMTigr:IPR005272"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456931.1"
FT                   /protein_id="ABX20435.1"
FT                   /translation="MDVGTIMDNSDCTASYSRVFATRAEAEETLAALTEKARSVESEPC
FT                   QITPTFTEESDGVRLDIDFVFACEAETLIFQLGLR"
     atggacgttg gaaccatcat ggacaactcc gattgcaccg cgtcatacag tcgcgtattc        60
     gctacccgtg cagaggctga agagacgctg gcggcgttaa ccgaaaaagc gcgtagcgtg       120
     gagtctgagc cttgccaaat tacgccaacc ttcaccgagg aatctgacgg tgttcgtctg       180
     gatatcgatt ttgttttcgc ctgcgaagca gaaacgctta tcttccagct aggcctgcgt       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page