(data stored in SCRATCH zone)

EMBL: CP000880.PE484

CP000880.PE484       Location/Qualifiers
FT   CDS_pept        513185..513670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2619 1.7e-81 phosphohistidine
FT                   phosphatase K08296; COG: COG2062 Phosphohistidine
FT                   phosphatase SixA; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20438"
FT                   /db_xref="GOA:A9MJ38"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ38"
FT                   /inference="protein motif:HMMPfam:IPR013078"
FT                   /inference="protein motif:HMMTigr:IPR004449"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456928.1"
FT                   /protein_id="ABX20438.1"
FT                   /translation="MQVFIMRHGDAALDAASDSVRPLTSCGCDESRLMANWLKGQKVDI
FT                   ERVLVSPFLRAEQTLDVVGDCMNLPAQVDVLPELTPCGDVGLVSAYLHALANEEIESVL
FT                   VISHLPLVGYLVSELCPGETPPMFTTSAIANVTLDESGKGTFNWQMSPCNLKMAKAI"
     atgcaagttt ttatcatgcg tcacggcgac gcagccctcg atgccgccag tgattcggtt        60
     cgtcccttaa cctcgtgtgg ttgtgacgag tctcgcctga tggcgaactg gctgaaaggt       120
     caaaaagtgg atatcgaacg tgttctggtt agtccgtttc ttcgggccga acagacgtta       180
     gatgtggtcg gcgattgtat gaatctgcca gctcaggtgg atgtcctgcc ggagctaacg       240
     ccctgcggcg atgtcggtct ggtcagcgcc taccttcatg ctctggccaa tgaagagatc       300
     gagtcggtac tggtgatctc tcacttacct ctggtcggat acctggtatc tgagctttgt       360
     ccgggcgaaa cgccgccgat gttcacgacg tccgcaattg ccaacgtcac gcttgatgaa       420
     agcggcaaag ggacatttaa ctggcaaatg agtccctgca atctgaaaat ggcgaaagcg       480
     atttaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page