(data stored in SCRATCH zone)

EMBL: CP000880.PE489

CP000880.PE489       Location/Qualifiers
FT   CDS_pept        516492..517316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0481 2.2e-150 mepA;
FT                   penicillin-insensitive murein endopeptidase precursor
FT                   K07261; COG: COG3770 Murein endopeptidase; Psort location:
FT                   Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20443"
FT                   /db_xref="GOA:A9MJ43"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ43"
FT                   /inference="protein motif:BlastProDom:IPR005073"
FT                   /inference="protein motif:HMMPfam:IPR005073"
FT                   /inference="protein motif:HMMPIR:IPR005073"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456924.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20443.1"
FT                   /translation="MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSVGSFANGCI
FT                   IGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAHQRGLGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASL
FT                   IKLAAEDNDVTRIFVNPAIKQQLCLDAGSDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL"
     atgaaaaaaa ccgcaattgc gctgctggca tggtttgtca gtagcgccag cctggcggcg        60
     acgccatggc agaaaataac ccatcctgtc cccggcgccg cccagtctgt cggtagcttt       120
     gccaacggat gcatcatcgg cgccgacacg ttgccggtac agtccgacaa ttatcaggta       180
     atgcgcaccg atcagcgccg ttatttcggc cacccggatc tggttatgtt tatccagcgg       240
     ttgagtcatc aggcgcatca acgggggctc ggaaccgtcc tgataggcga catggggatg       300
     cctgccggag gccgctttaa tggcggacac gccagtcatc agaccgggct tgatgtggat       360
     attttcttgc agttgccgaa aacgcgctgg agccaggcgc agctattgcg cccgcaggcg       420
     ttagatctgg tgtcccgcga cggtaaacat gtcgtgccgt cgcgctggtc gtcggatatc       480
     gccagtctga tcaaactggc ggcggaggac aatgacgtca cccgtatttt cgtcaatccg       540
     gctattaaac aacagctttg tctcgatgcc ggaagcgatc gtgactggct acgtaaagta       600
     cgcccctggt tccagcatcg cgcgcatatg cacgtgcgtt tacgctgccc tgccgacagt       660
     ctggagtgcg aagatcaacc tttacccccg ccgggcgatg gatgcggcgc tgaactgcaa       720
     agctggttcg aaccgccaaa acctggcacc acaaagcctg agaagaagac accgccgccg       780
     ttgccgcctt cctgccaggc gctactggat gagcatgtac tctaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page