(data stored in SCRATCH zone)

EMBL: CP000880.PE495

CP000880.PE495       Location/Qualifiers
FT   CDS_pept        complement(522576..523094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00523"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26784 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20449"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ49"
FT                   /inference="similar to AA sequence:INSD:AAV76490.1"
FT                   /protein_id="ABX20449.1"
FT                   /translation="MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTP
FT                   DDTTALMQRYVAKEVIHRLALIQSLYEQAIVGADYFMYAQDYAPEWIPQLRVGKAHPFL
FT                   GGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRDADKGYEQPIYDAGAITQAEAWSA
FT                   KIATEYEKY"
     atgaaaacgt tctcccttgt cgcgcttatc ctgttgcttt gtagttgctc tgcgcctcat        60
     cacgacagta cgcaggccgt gaagcagttc tatacttcat ggatgacgac gttcacgaac       120
     gatgtgaata cccctgacga caccaccgcc ttaatgcaac gttacgttgc taaagaggtt       180
     attcatcgcc tggcgctaat acagtccctt tatgagcagg cgattgtggg ggcagattat       240
     tttatgtatg cgcaggacta tgcgccagag tggattccac agttacgggt tgggaaggca       300
     caccctttcc tcggcggaga aaaagtggat gttctgttgg gtacagagtc aacgcccatc       360
     catttggaag tttatacccg ttgggaagag ggacgctgga aaatttaccg cgttcgggat       420
     gctgacaagg gttatgaaca gccgatttat gacgcaggcg ccatcaccca ggctgaggca       480
     tggtcagcga aaatcgcaac agaatatgag aagtattaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page