(data stored in SCRATCH zone)

EMBL: CP000880.PE5

CP000880.PE5         Location/Qualifiers
FT   CDS_pept        7823..9118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2822 4.7e-221 ygcA; putative RNA
FT                   methyltransferase K03215; COG: COG2265 SAM-dependent
FT                   methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19959"
FT                   /db_xref="GOA:A9MEG5"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A9MEG5"
FT                   /inference="protein motif:HMMPfam:IPR002792"
FT                   /inference="protein motif:HMMPfam:IPR010280"
FT                   /inference="protein motif:HMMTigr:IPR001566"
FT                   /inference="protein motif:ScanRegExp:IPR010280"
FT                   /inference="similar to AA sequence:SwissProt:Q5PEJ4"
FT                   /protein_id="ABX19959.1"
FT                   /translation="MAQFYSAKRRVTTRQIITVKVNDLDPFGQGVARHNGKALFIPGLL
FT                   PEESAEVIITEDKKQFSRARVLRRLNDSPERETPRCPHFGVCGGCQQQHIGIALQQRSK
FT                   SAALARLMKHEVNDIIAGAPWGYRRRARLSLNCLSDKTLQMGFRKAGSNDIVNVEQCPI
FT                   LAPQLEALLPRIRACLTSLHGTRHLGHVELVQAGNGTLMILRHTAPLSAADKEKLERFS
FT                   HSEGLSLFLAPFSEILESVTGETPWYDSHGLRLAFSPRDFIQVNEAVNQQMVARALEWL
FT                   DVRAEDRVLDLFCGMGNFTLPLATSAASVVGVEGVPALVEKGRENAIRNGLHNVTFFHE
FT                   NLEEDVTKQPWAKNGFDKVLLDPARAGATGVMRHIIKLKPIRVVYVSCNPATLARDSEA
FT                   LVNAGYEATRLAMLDMFPHTGHLESMVLFVRM"
     atggcgcaat tctactctgc aaaacggcgc gtgacgacgc gtcagatcat aaccgttaaa        60
     gtcaatgacc tcgatccatt tggtcagggc gtagctcgtc ataacggaaa ggcgctgttt       120
     attcccggtt tattgcctga ggaaagcgcg gaagtcatta ttacagaaga taaaaagcaa       180
     ttttcccgcg cacgtgtttt gcgccgttta aatgatagcc cagaacgaga aacgccgcgc       240
     tgtccgcatt ttggcgtctg cggcggttgc cagcaacagc atatcggcat tgctctgcaa       300
     caacgcagca aaagcgcggc gctggcgcgt ttgatgaaac acgaggtgaa tgacatcatc       360
     gccggtgcgc cctggggtta taggcgtcgt gcgcggttaa gtctaaattg tctgtcggat       420
     aaaacgctgc aaatgggatt tcgcaaagcg ggttccaacg atattgtcaa tgtagaacag       480
     tgccctattt tggcgcccca gcttgaggca ttgctgcccc gaatcagagc gtgtctgacg       540
     agtttacacg gcacccgaca tctcgggcat gtcgagctgg tacaggcggg aaacggtacg       600
     ctgatgattt tgcgccatac cgcgccattg agtgcggcgg ataaagaaaa actggaacgc       660
     ttttcgcatt ctgagggatt gtctctgttt ctggcaccgt ttagcgagat actggaatcg       720
     gtaactggcg aaacgccctg gtatgattcg cacggcttgc gtttagcctt cagtccgcga       780
     gactttattc aggttaatga agcggtaaac caacaaatgg tcgcccgcgc gctggaatgg       840
     cttgatgtgc gcgccgagga tcgtgtcctg gatctgttct gcggaatggg gaattttacg       900
     ttgccgctgg caacgagcgc agcaagcgtg gtgggggttg agggcgttcc ggcgctggta       960
     gaaaaaggac gtgaaaacgc catccgcaat gggttacata atgtgacatt ctttcatgag      1020
     aaccttgagg aagatgtcac gaagcagccg tgggcgaaaa acggctttga caaagtctta      1080
     cttgatcctg cgcgagcggg ggctacagga gtgatgcgac atattataaa attaaaacct      1140
     attcgcgttg tttatgtatc ctgtaatccg gcgacgctgg cgcgcgacag tgaagcgctg      1200
     gtaaatgcag gatatgaggc tacgcgttta gcgatgctcg acatgttccc gcacacagga      1260
     catctggaat caatggttct gttcgtgcgc atgtaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page