(data stored in SCRATCH zone)

EMBL: CP000880.PE509

CP000880.PE509       Location/Qualifiers
FT   CDS_pept        534388..535905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0502 2.5e-270 purF;
FT                   amidophosphoribosyltransferase K00764; COG: COG0034
FT                   Glutamine phosphoribosylpyrophosphate amidotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20463"
FT                   /db_xref="GOA:A9MJ63"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ63"
FT                   /inference="protein motif:HMMPanther:IPR005854"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005854"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149816.1"
FT                   /protein_id="ABX20463.1"
FT                   /translation="MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVNDIFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPHGIRPLVLGKRDVGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAIYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLDDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDFLDSLRNDDAKAVLFQNEMENLEMHNEG"
     atgtgcggta ttgtcggtat cgccggtgtt atgccggtca accagtcgat ttatgacgcg        60
     ttaacagtgc tccagcatcg tggtcaggat gctgccggta ttatcaccat agatgcgaat       120
     aactgcttcc gcctgcgtaa ggcaaacggg ctggtgaacg atatttttga agctcgccac       180
     atgcagcgtt tgcagggcaa catggggatc ggccatgtgc gttaccctac cgcaggcagc       240
     tccagcgctt ccgaagcgca acctttttac gttaattcgc cgtatggcat cacgttggcc       300
     cataatggca acctgactaa cgcgcatgag ctgcgtaaaa aactgtttga agaaaagcgc       360
     cgtcatatca acacgacttc cgattccgaa atcctgctaa atattttcgc cagcgagctc       420
     gacaacttcc gtcactaccc gctggaagcc gacaatattt ttgccgcgat tgccgcgact       480
     aaccgtcaga tccgtggcgc ctatgcctgc gtggcgatga ttatcggtca cggcatggta       540
     gcctttcgcg atccgcacgg cattcgccca ttggtgctgg gtaagcgtga cgttggcgat       600
     ggtcgtacag agtatatggt cgcttcagaa agcgtggcgc tggatacact gggctttgaa       660
     tttctgcgcg atgtcgcgcc gggcgaagct atctatatta ccgaaaaggg gcaactgttc       720
     acgcgccagt gcgcggataa tccggtcagt aacccctgtt tgttcgagta cgtttacttt       780
     gcccgtcctg actcctttat cgataagatc tccgtctaca gcgctcgtgt gaatatgggc       840
     actaaacttg gcgaaaaaat cgctcgtgaa tgggaagatc tggacatcga cgtagttatc       900
     cctatcccgg aaacctcctg cgatatcgca ctggaaattg cccgtattct cggcaagccg       960
     taccgccagg gatttgtcaa aaatcgctac gtgggacgta cctttatcat gccgggccaa      1020
     caactgcgtc gtaaatctgt gcgccgcaag ctcaatgcta atcgcgcgga gttccgcgat      1080
     aaaaacgtcc tgctggtgga tgattctatc gtgcgtggca ccacatcgga gcagatcatc      1140
     gagatggcca gggaagcggg cgcgaagaag gtttacctgg cgtccgccgc gccggaaatt      1200
     cgtttcccca acgtctatgg cattgatatg ccgaccgcca atgagctgat cgcgcatggt      1260
     cgagaggtgg acgaaattcg tcagatcatc ggcgccgatg ggcttatctt ccaggatctg      1320
     gacgatctga tcgaagccgt gcgcgcggaa aacccggata ttcagcagtt tgaatgttcg      1380
     gtatttaacg gggtatatgt taccaaagac gtagatcagc aatacctcga cttcctggat      1440
     tcattacgta atgacgacgc caaagcggtg ctgttccaga acgaaatgga aaacctggaa      1500
     atgcataacg aaggttaa                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page