(data stored in SCRATCH zone)

EMBL: CP000880.PE511

CP000880.PE511       Location/Qualifiers
FT   CDS_pept        537580..538977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0504 7.3e-255 putative amino acid
FT                   decarboxylase K01586; COG: COG0019 Diaminopimelate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20465"
FT                   /db_xref="GOA:A9MJ65"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ65"
FT                   /inference="protein motif:HMMPfam:IPR000183"
FT                   /inference="protein motif:superfamily:IPR009006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456902.1"
FT                   /protein_id="ABX20465.1"
FT                   /translation="MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYP
FT                   TPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQY
FT                   EVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKV
FT                   ANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQ
FT                   VPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAG
FT                   ITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVEC
FT                   HVEWKFVDAGYSVLSDSQHFDWFFYVYNASRITAAHDAWIKLAGPLCDGGDYFHMGVKG
FT                   EEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGETRLIRREDSYED
FT                   MVKYDIY"
     atgactgact cgattatgca gaattacaac cagctacgtg agcaggtaat caacggcgat        60
     cgccgtttcc agcacaaaga cggtcatttg tgttttgaag gggtcgatct ggacgctctg       120
     gcgcgccagt accccacgcc attctatgtg ttttctgagc cggagattat tcgtaacatt       180
     catgaaatcc agcaggcatt tgcggcgcat aaaaatacta aaaccttctt tgcgtcaaaa       240
     acctgctcgg tcatgggcgt gttgaaagcc attcgcgacg ccggaatttg cgcggaggca       300
     aactcacaat atgaggttcg caagtgtctg gagataggtt ttcgcggcga tcagatcgtc       360
     ttcaatggcg tggtgaaaaa gcctgccgat ctggaatatg ccatcgccaa cgatctgtat       420
     cttattaatg ttgatagcct gtatgagctg gaacatattg atgccatttc tcgcaagctg       480
     aagaaagtcg ccaatgtttg cgtccgcgta gagccgaatg ttccctcggc gacgcatgcg       540
     gaactggtta ccgctttcca tgcgaagtcg ggccttgacc tggaacaggc ggaagaaacc       600
     tgccgccgca ttctggcgat gccttatgtg catttacgcg gcttgcatat gcatgtgggc       660
     gatcaggtgc cggagtcaga gcctttcgca aaagcgacca aagtgctggt ggatgaatcc       720
     cgtcgcctgg aagaagtgct cggtattaaa tttgatttga tcaacgtggg cggtgggatt       780
     ccggttccct ataaatatga cgacgagaat ggcgacccgt taaaagataa tatgtatgcc       840
     ggtattaccg cccaggattt tgccgatgcg gtcattcgcg aagtgcataa atggcgtacc       900
     gatgtggaaa tatgtattga acccggacgt aaagtgaccg ggtcggcggc ggttttactg       960
     acggaagtct cctgcgaaaa acgtaaaaca aattacgatc ttaacggcaa tgtggaatgc      1020
     cacgttgaat ggaaatttgt cgacgccggt tacagcgtac tctctgacag ccaacatttt      1080
     gactggttct tttatgtcta taacgcctct cgcatcacgg cagcgcacga cgcctggata      1140
     aaattagccg ggccgctgtg tgatggcggg gattatttcc acatgggggt gaaaggcgaa      1200
     gagtttttac tgccgaagga gactcatgtt ggcgatattg tcgcgtttct tgatgctggg      1260
     gcatacacca ttgaaagtca aaccgtttat aacaaccgtc cgcgcacggg cgtggtgatg      1320
     atcgataaaa atggtgagac gcgtctgatt cgtcgggaag acagttacga agatatggtc      1380
     aagtacgaca tctattaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page