(data stored in SCRATCH zone)

EMBL: CP000880.PE513

CP000880.PE513       Location/Qualifiers
FT   CDS_pept        540491..541594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC2063 4.0e-05 alanine racemase K01775;
FT                   COG: COG3457 Predicted amino acid racemase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20467"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ67"
FT                   /inference="protein motif:HMMPfam:IPR001608"
FT                   /inference="similar to AA sequence:INSD:AAV76508.1"
FT                   /protein_id="ABX20467.1"
FT                   /translation="MYMPVLEINLRKLEENARTEKALLASSGIEVMAVNKVFDGCVETA
FT                   QAVFNGGITVIAESRTYNLKKIRETGCTTCLLRSPCLSEIEDVVRYADISLNSEPVVLR
FT                   ALSHEAQRQGKTHQVLLMVDMGDLREGIWFSEYQRILETITLIADLPALELYGLGTNFN
FT                   CYGTVLPTVKNGEDFLALAARLEADSGIPVRRLSAGNCTSYHLLDKGIWPHGLNHLRIG
FT                   GLHEFGIEYVDMKYLNEFHHSAKPVDKACSDMYILEAEIIELNSKPTVPVGELGVDAFL
FT                   QSKTFVDRGIRRRALLAFGRQDVPSDNCVPCDDAITILGQTSDHTLVDIEDCRQPLKVG
FT                   DVVRFELDYTGLLMACQTKGIAWRFTR"
     atgtatatgc cagttctcga aataaatcta cgcaagctgg aagagaacgc ccgcacggaa        60
     aaagcactgc tggcaagcag cggtattgaa gtgatggctg tcaataaagt ttttgacggc       120
     tgcgtggaaa ccgcgcaggc ggttttcaac ggcggaatta ccgttattgc tgaatcacga       180
     acctataact tgaaaaaaat acgcgagaca ggatgtacga cctgcctgtt acgtagcccg       240
     tgtctgagtg aaatcgagga tgtcgtgcgc tacgcggata tcagtttaaa tagcgagccg       300
     gtcgtattac gggcattatc gcatgaagcc caacgccagg ggaaaacgca tcaggtatta       360
     ctaatggtag atatgggcga tttacgcgag ggtatctggt ttagcgaata tcaacgtatt       420
     cttgagacca ttacccttat tgctgacctg cccgctctgg aattatatgg actgggtacc       480
     aactttaatt gttacggcac cgtattgcca acagtaaaaa atggcgagga ttttctggcg       540
     ctggccgccc ggctggaagc cgacagcggt attcctgtcc ggcggctttc tgcggggaac       600
     tgcactagct atcacctgct ggataaaggt atctggccgc acgggctgaa tcatttgcgc       660
     atcggcgggc tacatgagtt cggcattgaa tatgtcgaca tgaaatacct gaatgaattt       720
     caccactccg caaaaccggt cgataaagcc tgttctgata tgtatatcct ggaagcggaa       780
     attatcgaac tgaacagtaa accgaccgta ccggtcgggg aactgggcgt cgatgccttt       840
     ttgcaaagta aaacctttgt cgatcgtggc atacgccgac gcgcattgct ggcgtttggg       900
     cgccaggatg tgccgtcgga taactgtgtg ccgtgcgatg acgctatcac tatcttagga       960
     caaaccagcg atcatacatt agtcgatatt gaagattgtc gtcagccgct aaaagtaggc      1020
     gatgtagttc gctttgaact ggattatacg ggcctgttaa tggcctgcca gaccaaaggc      1080
     atcgcctgga ggtttacgcg ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page