(data stored in SCRATCH zone)

EMBL: CP000880.PE515

CP000880.PE515       Location/Qualifiers
FT   CDS_pept        542988..543557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0508 4.6e-95 ubiX; putative decarboxylase
FT                   K03186; COG: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20469"
FT                   /db_xref="GOA:A9MJ69"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ69"
FT                   /inference="protein motif:Gene3D:IPR003382"
FT                   /inference="protein motif:HMMPfam:IPR003382"
FT                   /inference="protein motif:HMMTigr:IPR004507"
FT                   /inference="protein motif:superfamily:IPR003382"
FT                   /inference="similar to AA sequence:INSD:AAX66264.1"
FT                   /protein_id="ABX20469.1"
FT                   /translation="MKRLIVGISGASGAIYGVRLLQILRDVESVETHLVMSQAARQTLA
FT                   LETHFSLREVQALADVTHDARDIAASISSGSYPTAGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVILKERRPLVLCVRETPLHIGHLRLMTQAAEIGAVIMPPVPAFYHLPKTLDDVI
FT                   NQTVNRVLDQFDIPLPHDLFVRWQGA"
     atgaaacgac ttattgtagg aataagcggc gccagcggag cgatttatgg cgtgcgctta        60
     ttacaaattt tgcgcgatgt cgagagcgtg gaaacgcatc tggtgatgag ccaggcggcc       120
     cggcaaacgc tggcgctgga gacccatttt tcattgcgcg aggtgcaggc gctggctgac       180
     gtgacgcacg atgcgcgcga tattgccgcc agtatttctt cgggctctta cccgacggcg       240
     ggaatggtta tcctgccttg ttccattaaa acgctttcgg ggattgtcca cagttatact       300
     gacggactgc ttacccgcgc ggcggatgtg atattaaaag agcggcgacc tctggtgctg       360
     tgtgtgcgcg aaacgccgct acatatcggg catttgcgtt taatgaccca ggccgctgag       420
     ataggcgcgg tgattatgcc gccggttccg gccttttatc atcttcctaa aacccttgat       480
     gatgttataa atcaaactgt taatagggtt ctggatcagt ttgatattcc acttccgcat       540
     gatctttttg ttcgttggca gggcgcatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page