(data stored in SCRATCH zone)

EMBL: CP000880.PE521

CP000880.PE521       Location/Qualifiers
FT   CDS_pept        complement(548047..548940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0206 9.2e-58 hypothetical protein;
FT                   COG: COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20475"
FT                   /db_xref="GOA:A9MJ75"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ75"
FT                   /inference="protein motif:HMMPanther:IPR010099"
FT                   /inference="protein motif:HMMPfam:IPR001509"
FT                   /inference="protein motif:HMMPfam:IPR013549"
FT                   /inference="protein motif:HMMTigr:IPR010099"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461292.1"
FT                   /protein_id="ABX20475.1"
FT                   /translation="MQILITGGTGLIGRHLIPRLLTLGHQVTVVTRNPYNARQIFDSRV
FT                   ALWKGLAEREHLNEIDAIVNLAGEPIADKRWTPQQKERLCQSRWAITQKLVDLIHASAT
FT                   PPAVLISGSATGYYGDLGDVVVTEDEPPHNEFTHKLCALWEQIACRAQSDQTRVCLLRT
FT                   GVVLAPQGGILGKMVPPFRLGLGGPVGNGRQYLPWIHIDDMVNGILWLLDNDLRGPFNM
FT                   VSPYPVHNEQFAHALGRALRRPAIIRIPATAIRLLMGESSVLVLGGQRALPKRLEAAGF
FT                   AFRWYDLEEALADVIR"
     atgcagattc tgattaccgg cggtacaggc ctgattgggc gtcatctaat tcctcgtctg        60
     ttaacactgg gacatcaggt gacagtcgtt acgcgcaatc cctacaatgc gcgtcagatt       120
     ttcgattcca gagtggcatt atggaaaggg ctagcggaac gtgagcacct caatgaaatt       180
     gacgccatcg tcaatctggc tggcgaaccg attgccgaca aacgctggac gccgcagcaa       240
     aaagaacggc tgtgccaaag tcgctgggct atcacgcaaa agctggtgga tttaattcat       300
     gccagcgcaa cgccgcctgc ggtgttgata tccggttccg ccacgggcta ttacggcgat       360
     ctgggcgacg ttgtcgtcac tgaagacgaa ccgccgcaca atgaatttac gcataaactt       420
     tgcgccctct gggagcagat tgcctgtcgc gcgcagagcg atcagacccg cgtctgcctg       480
     ctgcgtaccg gcgtcgtact ggcgccgcaa ggcgggattc tggggaaaat ggttccgccg       540
     ttccgcctcg gtctcggcgg cccagtgggt aatggtcgac aatatctgcc ctggattcac       600
     attgacgata tggtcaacgg catcctgtgg ctgctggata acgatcttcg cggtcctttc       660
     aatatggtct cgccgtatcc cgtccataat gaacagtttg ctcatgcgct gggacgcgcg       720
     ctgcgccgcc cggcaattat acgcattccg gcgacggcaa ttcgcttatt gatgggagag       780
     tcgtcagtgt tggtactggg cggacagcgg gcgttgccaa aacggcttga agccgccgga       840
     ttcgcgtttc gctggtatga tttagaagag gcgctggcag atgtgattcg ctag             894
//

If you have problems or comments...

PBIL Back to PBIL home page