(data stored in SCRATCH zone)

EMBL: CP000880.PE533

CP000880.PE533       Location/Qualifiers
FT   CDS_pept        complement(557032..558552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00561"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1288 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20487"
FT                   /db_xref="GOA:A9MJ87"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ87"
FT                   /inference="protein motif:HMMPfam:IPR004669"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804382.1"
FT                   /protein_id="ABX20487.1"
FT                   /translation="MSVVTESKPARKWAMPDTLVIIFFVAILTSIATWVVPVGMFDSQE
FT                   VQYQVDGQTKTRKVVDPHSFRIVTNEAGEAQYHRVQFFTTGDERPGLMNFPFEGLTSGS
FT                   KFGTAVGIIMFMLVIGGAFGIVMRTGTVDNGILALIRHTRGNEVLFIPVLFVLFSLGGA
FT                   VFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAG
FT                   VPVLSGSGLRIVVWIVATLIGLVFTLVYASRVKKNPQLSRVHESDRYFREQQDEVVQRP
FT                   FTFGDWLVLLVLTGVMIWVVWGVIVHAWFIPEIASQFFTMGVVIGLIGVIFRLNGMTVN
FT                   VMASSFTEGARMMIAPALLVGFAKGILLLVGNGEAGEPSVLNTLLNSIAHGISGLNNAI
FT                   AAWFMLLFQAVFNFFVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIY
FT                   PTSASLMATLGVCRVDFRNWLKVGASLLGLLFIMSSVVVIGAQMMGYH"
     atgtctgtcg tcacagaatc aaaaccagcc agaaaatggg cgatgcccga tacgctggtc        60
     atcatctttt ttgtcgccat tttaaccagt atcgccacat gggtcgtacc cgttgggatg       120
     tttgatagcc aggaggtgca gtatcaggtc gatggccaga caaaaacccg gaaagtcgtc       180
     gatccacact cttttcgcat tgtgaccaat gaggccggtg aagcgcagta tcatcgcgta       240
     caatttttca ctaccggcga tgaaaggccg gggctaatga attttccatt tgaagggtta       300
     acgtccggct caaaattcgg cactgccgtc ggcatcatta tgtttatgtt ggtgattggc       360
     ggcgcattcg gcatcgtgat gcgtaccgga accgtagata acggcattct ggcgctgatt       420
     cgccacacgc ggggtaacga agttttattt attccggtgc tgtttgttct cttttcgtta       480
     gggggcgcag tattcggcat gggggaagag gcggtcgcct ttgcgattat cattgccccg       540
     ctgatggtca gactaggcta cgacagcatt accaccgtcc tggtgactta tatcgccacc       600
     caaattggct ttgccagttc gtggatgaac cccttctgcg tggtcgtcgc ccaggggatt       660
     gccggcgtgc cggtactttc cggctccggg ctgcgtattg tggtctggat tgtcgccacg       720
     ctgattggac tggtttttac cctggtttac gcctcacgcg tgaaaaagaa tccgcagctc       780
     tcacgcgtcc acgaatccga tcgctatttc cgcgaacagc aggatgaagt cgtccagcgc       840
     cctttcacct tcggtgactg gctggtactg ctggtcctga ccggcgtaat gatttgggtc       900
     gtctggggcg tgattgtcca cgcctggttt attccggaga tcgccagcca gtttttcacc       960
     atgggcgtgg tgatcggcct catcggcgtt atcttccgcc tcaacggaat gacagtcaac      1020
     gtaatggcgt cctcatttac cgaaggggcg agaatgatga tcgcgcccgc gctgctggtc      1080
     ggttttgcca aaggcattct gctgctggta ggcaacggcg aagccggaga acccagcgtg      1140
     cttaatacgc tgcttaatag tatcgcgcat ggcataagcg ggcttaataa tgctatcgcc      1200
     gcctggttta tgctgctctt ccaggcggta tttaatttct ttgtgacgtc cggttcgggt      1260
     caggcggcgt taaccatgcc attgctggcg ccgctcggcg atctggtcgg cgttaaccgt      1320
     caggtgacgg tcctggcctt ccagtttggt gatggcttca gccatattat ctatccgaca      1380
     tcggcctcgc tgatggccac gctgggcgtg tgccgggtcg attttcgcaa ctggcttaaa      1440
     gtgggggcgt cgctgctggg actgctgttt attatgtcca gtgtagtcgt cattggcgcg      1500
     cagatgatgg gctatcattg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page