(data stored in SCRATCH zone)

EMBL: CP000880.PE67

CP000880.PE67        Location/Qualifiers
FT   CDS_pept        67567..68139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3328 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20021"
FT                   /db_xref="GOA:A9MF69"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF69"
FT                   /inference="protein motif:HMMPfam:IPR001207"
FT                   /inference="similar to AA sequence:REFSEQ:NP_783715.1"
FT                   /protein_id="ABX20021.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKPLTEAALAAELDS
FT                   HLASDVEANRKNGSGKKTIKAATGSFELATPRDRNGTFEPQLVKKHQTTLSDEIVHKII
FT                   RLFALGMSCQDISREIEDLYALSVSTATISAVTDKVIPELKQWQQRPLEKVYPFVRLDA
FT                   IHYKVREDGAIRCGSFYHDAMGKAVAG"
     atgtcccagc ccttcgattt cgacaaagcg cttaaggcac tccagtctgg ccaggcatta        60
     accggtaaag atgggatctt aactccatta atcaaaccgt taacagaagc tgcattggct       120
     gctgaactgg actcacatct cgcttcggat gttgaagcca accgtaaaaa cggctccggc       180
     aaaaaaacca ttaaggccgc cacaggttcc ttcgaactcg ccactccccg tgatcgcaac       240
     ggcacttttg agccacaact ggtgaaaaaa caccagacca ctctctctga tgagatcgta       300
     cacaaaatta ttcgcctgtt cgcgctgggg atgagctgtc aggatatcag ccgggagatt       360
     gaggacttgt atgccctcag cgtctcgacg gcgactatca gcgccgtgac agacaaagtt       420
     atcccggaac tgaaacagtg gcagcagcgc ccgctggaga aggtgtatcc ctttgtccgg       480
     ctggatgcta tccattataa agtccgggag gatggagcta taagatgtgg gtctttctac       540
     catgacgcga tgggtaaagc cgttgcggga tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page