(data stored in SCRATCH zone)

EMBL: CP000880.PE77

CP000880.PE77        Location/Qualifiers
FT   CDS_pept        76615..77022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00078"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG14129 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20031"
FT                   /db_xref="InterPro:IPR003065"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF79"
FT                   /inference="protein motif:BlastProDom:IPR003065"
FT                   /inference="protein motif:FPrintScan:IPR003065"
FT                   /inference="protein motif:HMMPfam:IPR003065"
FT                   /inference="similar to AA sequence:INSD:CAD06002.1"
FT                   /protein_id="ABX20031.1"
FT                   /translation="MQHLDIAELVRSALEVSGCDPSLIGGIDSHSTIVLDLFALPSICI
FT                   SVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCQFVRGGQLLLGEQNGELTLKALV
FT                   HPDFLSDGEKFSNALNGFYNYLEVFSRSLMR"
     atgcaacatt tggatattgc tgagttagtt cgttccgcac tggaagtaag tggttgcgat        60
     ccttcgctaa ttggaggaat agatagccat tcgacaattg ttctggattt atttgcattg       120
     cccagtattt gtatcagcgt caaggacgat gatgtatgga tctgggcgca attgggtgct       180
     gatagcatgg tggtattaca acaacgggcc tatgaaatct taatgaccat aatggaagga       240
     tgccagtttg tccgcggcgg gcaattgcta ttaggggagc agaatgggga actaacgctt       300
     aaggccttag tgcatccgga ttttttatct gacggtgaaa agttctctaa tgccttgaat       360
     ggattttaca actatctgga agtttttagt cggtcgctaa tgagatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page