(data stored in SCRATCH zone)

EMBL: CP000880.PE79

CP000880.PE79        Location/Qualifiers
FT   CDS_pept        78391..78735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:282041 0.0055 ROCK2; Rho-associated,
FT                   coiled-coil containing protein kinase 2 K04514; COG:
FT                   NOG18535 non supervised orthologous group; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20033"
FT                   /db_xref="InterPro:IPR002954"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF81"
FT                   /inference="protein motif:HMMPfam:IPR002954"
FT                   /inference="similar to AA sequence:INSD:AAC45013.1"
FT                   /protein_id="ABX20033.1"
FT                   /translation="MLHAEEEAIVEQIAGLKLLLDTLRAENRQLSREEIYSLLRRQSIV
FT                   RRQIRDLQLQITQIQEKRCELEKKTQEFQEKSKYWLRKEGNYQRWIVRQKRFYIQREIQ
FT                   QEEAESEEII"
     atgctgcacg ctgaggagga ggcgatcgtt gaacaaatag cgggtctgaa attgctatta        60
     gatacgctgc gtgcagaaaa tagacagctc agtcgtgagg aaatttattc gttattacgt       120
     aggcaatcta ttgtccgtcg gcagataaga gatttacaac ttcagattac acaaattcag       180
     gaaaaacgat gcgaactgga aaagaaaact caagagtttc aggaaaaaag taaatattgg       240
     ttgcgcaaag aaggtaatta tcaacgttgg atagttcgtc agaaaagatt ctatattcag       300
     cgagagatac agcaggaaga ggccgagtca gaggagataa tttaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page