(data stored in SCRATCH zone)

EMBL: CP000880.PE80

CP000880.PE80        Location/Qualifiers
FT   CDS_pept        78735..79742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00081"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19627 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20034"
FT                   /db_xref="InterPro:IPR003066"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF82"
FT                   /inference="protein motif:HMMPfam:IPR003066"
FT                   /inference="similar to AA sequence:INSD:AAC45014.1"
FT                   /protein_id="ABX20034.1"
FT                   /translation="MGDVSAVSSSGNILLPQQDEVGGLSEALKKAVEKHKTEYSDDKKD
FT                   REYGDTFMMHKETALPLLLAALRHGAPAKSEQHNGSVSGLHHNVKGELRIAEKLLKVTA
FT                   EKSVGLVSTEAVDKFAALQSSKNRQLEGVSGKKLSADLKAVESLSELADKAAERTDDNI
FT                   KVLPGDNKVIAGEGVRKEGALLARDVAPSRMAAANTSKFDDKEHKKIKEASQVPLQPTT
FT                   IADLSQLSGGDEKMPLAAQSKPMMTIFPTADGVKGEDSSLTYRFQRWGNDYSVNIQARQ
FT                   VGEFSLIPSNTQVEHRLHDQWQNGNPQRWHLTRDDQQNPQQQQHGQQSGEEDDA"
     atgggcgatg tgtcagctgt cagttcatcc ggaaacattt tactgccgca gcaggacgag        60
     gtcggcggtt tatcagaagc attaaaaaaa gcggtagaaa aacataaaac agaatattcc       120
     gatgataaaa aagatcgcga gtacggcgat actttcatga tgcataagga aacggcatta       180
     ccgcttttac tggcggcatt acggcatggc gcgccagcga aatcagaaca gcacaatggc       240
     agcgtttctg gcctacatca taatgtgaaa ggcgaactca ggattgctga gaaactattg       300
     aaagttactg ctgaaaaatc cgttggtttg gtctctacgg aagcagtgga taaattcgca       360
     gcactgcaat cgtctaaaaa taggcagtta gagggcgtaa gcggtaaaaa attatctgct       420
     gatttaaaag ctgtcgaatc cctcagtgaa ttagcggata aagccgcgga acgcactgac       480
     gataatatta aggtattacc tggggataat aaagtcatcg cgggcgaagg cgttcgtaaa       540
     gagggcgcgc tgctggcgcg agacgtcgca ccttcccgaa tggccgcggc gaataccagt       600
     aagtttgatg ataaagagca taaaaagatc aaagaggctt ctcaggttcc cctgcaacca       660
     acaactatcg ccgatcttag ccaattatcc ggcggcgatg aaaaaatgcc tttagcggcg       720
     caatcaaagc cgatgatgac tatttttccg accgccgatg gcgtgaaagg agaggatagc       780
     tcgttgactt accgcttcca gcgctgggga aatgactact ccgtcaatat tcaggcgcgg       840
     caggtagggg agttttcgtt aataccgtca aatacgcagg ttgagcatcg cttgcacgat       900
     caatggcaaa acggtaaccc ccagcgctgg cacctgacgc gagatgatca gcaaaatccg       960
     cagcagcaac agcacggaca gcaatctggc gaggaggatg acgcctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page