(data stored in SCRATCH zone)

EMBL: CP000880.PE85

CP000880.PE85        Location/Qualifiers
FT   CDS_pept        82385..83455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00086"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1377 Flagellar biosynthesis pathway,
FT                   component FlhB; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20039"
FT                   /db_xref="GOA:A9MF87"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF87"
FT                   /inference="protein motif:FPrintScan:IPR006135"
FT                   /inference="protein motif:HMMPfam:IPR006135"
FT                   /inference="protein motif:HMMTigr:IPR006307"
FT                   /inference="similar to AA sequence:INSD:CAA51927.1"
FT                   /protein_id="ABX20039.1"
FT                   /translation="MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSY
FT                   GSFNEFMGIIKIIIAENFEQSMADYSLAVLGVGLKYLIPFMLLCLVCSALPTLLQTGFV
FT                   LATEALKLNLSALNPVEGAKKLFSMRTVKDTVKTLLYLSSFVVAAIICWKKYKVEIFSQ
FT                   LNGNVMGIAVIWRELLLALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKE
FT                   QEGNPEVKSKRREVHMEILSEQVKSDIENSRLIVANPTHITIGIYFKPELMPFPMISVY
FT                   ETNQRALAVRSYAEKVGVPVIVDIKLARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVE
FT                   NAGKDVIQPQENEVRH"
     atgtcctcga ataaaacaga aaaacctact aaaaaacggc tggaagattc cgctaaaaag        60
     ggtcagtcat ttaaaagtaa agatcttatt atcgcctgtt tgactctggg aggaattgct       120
     tatctggtgt cgtatggctc atttaatgag tttatgggaa ttattaagat catcattgca       180
     gaaaattttg agcagagcat ggctgactac agtctggccg ttttaggggt agggttaaaa       240
     tacctgattc catttatgct actctgctta gtgtgttccg cattaccgac gttattacag       300
     acgggttttg tgctggcgac agaggcatta aaacttaatt tgtcggcatt aaacccggtc       360
     gaaggggcga aaaaactttt cagtatgcga acagtaaaag atacggtcaa aactttactg       420
     tatctctcat cctttgtggt ggccgcaata atttgctgga aaaaatataa ggttgaaatc       480
     ttttctcagt taaatggcaa tgttatggga attgccgtca tttggcgtga gcttcttctc       540
     gcgttggtat taacttgcct tgcctgtgca ttaattgttt tattattgga tgctatcgct       600
     gaatacttcc tgaccatgaa agatatgaaa atggataaag aagaagtgaa gcgtgagatg       660
     aaggagcagg aagggaaccc ggaggttaaa tctaaaagac gtgaagttca tatggaaatt       720
     ctgtctgaac aggtgaaatc tgatattgaa aactcacgtt tgattgttgc caacccaacg       780
     catattacga tcggtattta ttttaaacct gaactgatgc cgtttccgat gatctcagtg       840
     tatgaaacta atcagcgcgc actggccgtt cgctcctatg cggagaaggt tggcgtacct       900
     gttatcgtcg atatcaaact ggcgcgcagt cttttcaaaa cccatcgccg ttatgatttg       960
     gtgagtctgg aagaaattga tgaagtttta cgtcttctgg tttggctgga agaggtagaa      1020
     aacgcgggca aagatgttat tcagccacaa gaaaacgagg tacggcattg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page