(data stored in SCRATCH zone)

EMBL: CP000880.PE88

CP000880.PE88        Location/Qualifiers
FT   CDS_pept        85904..87133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00089"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10023 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20042"
FT                   /db_xref="GOA:A9MF90"
FT                   /db_xref="InterPro:IPR005427"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF90"
FT                   /inference="protein motif:HMMTigr:IPR005427"
FT                   /inference="similar to AA sequence:SwissProt:Q56020"
FT                   /protein_id="ABX20042.1"
FT                   /translation="MLINNAGINPATYLNNHSVENTPQPGSQSVSVKDILSSIGITVSK
FT                   VSDLGLSPTLTAPAPGVLTQTPGTVTSFLKTSIQNADMNQDLNALANNFSNKANELVQT
FT                   HLREQQAEVGKFFDISGMSSNAVALLAAANVLMLTLNQADTQLSSKLSLVSFDAAKTTA
FT                   SSMMREGMNALSGSISQSALQMGITTVGAKLEYKGLQNERGALKHNAAKIDKLTTESHS
FT                   IKNVLNGQNSVKLGSEGVDSLKSLNMKKTGADATKNLNDVTLKSNAGTSATESLGIKDS
FT                   NKQISPEHQAILSKRLESVESDIRLEQNTMDMTRIDARKMQMTGDLIMKNSVTVGGIAG
FT                   ASGQYAAIQERSEQQISQVNNRVASTASEETRESSRKSTSLIQEMLKAMESINQSKASA
FT                   FAAIAGNIRA"
     atgttgatta ataatgcggg gatcaatcct gctacttatt taaataatca ttctgttgag        60
     aatactccgc agcctggttc gcaatccgtt agcgtgaaag atattctgag cagcattggt       120
     attactgtta gtaaagtcag tgacctggga ctaagtccga cattgactgc gcctgcgcct       180
     ggagtattaa cgcaaacccc aggtacagta acttcctttt tgaaaaccag cattcagaat       240
     gccgatatga atcaggatct gaatgccctg gctaataatt ttagtaacaa agcgaacgaa       300
     ttggtgcaaa cccatctgcg ggagcaacag gctgaagtcg gaaaattttt tgatatcagc       360
     ggtatgtctt ccaatgctgt tgcgctattg gctgccgcga atgttttaat gctgacgttg       420
     aaccaggcag acacccaact gtccagtaaa ttgtcactcg tcagttttga cgccgcaaaa       480
     acgacggcaa gctccatgat gcgtgaaggg atgaatgcgt tgtccggtag tatttctcag       540
     agcgcgcttc agatggggat cactaccgtg ggcgcgaaac tggaatataa agggctgcag       600
     aatgagagag gcgcgcttaa acataatgct gcgaagatcg ataaactgac tactgaaagc       660
     cacagtatta aaaatgtgct gaacgggcag aatagtgtca agctcggttc agaaggcgtc       720
     gattctctga aatcgttaaa tatgaagaaa actggcgccg atgcgacgaa aaatcttaat       780
     gacgtgacgc ttaaatctaa tgccggaaca agtgccacag aaagcttggg cattaaagac       840
     agtaataaac aaatttcccc tgaacatcag gccattttgt cgaaacgtct tgagtctgtc       900
     gaatccgata ttcgtcttga gcagaatact atggatatga cccgaatcga tgcgcgtaag       960
     atgcagatga cgggcgattt gattatgaag aactcggtca ctgtcggtgg gatcgcggga      1020
     gcgtccggac agtacgccgc catccaggag cgttccgaac agcaaattag ccaggtgaat      1080
     aaccgggttg ccagcacggc atcggaagaa acgcgtgaga gttcacgtaa gtcgaccagc      1140
     ctgattcagg aaatgctgaa agcaatggaa agcattaacc agtcgaaagc atccgcattc      1200
     gccgctatcg cgggaaatat tcgcgcttaa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page