(data stored in SCRATCH zone)

EMBL: CP000880.PE9

CP000880.PE9         Location/Qualifiers
FT   CDS_pept        14218..15516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2853 4.4e-225 eno; enolase K01689; COG:
FT                   COG0148 Enolase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19963"
FT                   /db_xref="GOA:A9MF11"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF11"
FT                   /inference="protein motif:BlastProDom:IPR000941"
FT                   /inference="protein motif:FPrintScan:IPR000941"
FT                   /inference="protein motif:HMMPanther:IPR000941"
FT                   /inference="protein motif:HMMPfam:IPR000941"
FT                   /inference="protein motif:HMMTigr:IPR000941"
FT                   /inference="protein motif:ScanRegExp:IPR000941"
FT                   /inference="similar to AA sequence:INSD:AAX66792.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX19963.1"
FT                   /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKS
FT                   NFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEA
FT                   LAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELT
FT                   KQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSIL
FT                   IKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
FT                   SDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA"
     atgtccaaaa tcgttaaagt catcggtcgt gaaatcatcg actcccgtgg taacccgact        60
     gttgaagctg aagtacacct ggaaggtggt ttcgtaggta tggcggcggc gccgtcaggt       120
     gcttctactg gttcccgcga agcgctggaa ctgcgcgatg gcgacaaatc ccgtttcctg       180
     ggtaaaggcg tcaccaaagc tgttggtgcg gttaacggcc cgatcgctca ggctattctt       240
     ggtaaagacg ctaaagacca ggctggcatt gataaaatca tgatcgacct ggacggtact       300
     gaaaacaaat ctaacttcgg tgcaaacgcc attctggctg tttctctggc taacgccaaa       360
     gctgctgctg ccgctaaagg tatgccgctg tacgagcaca ttgccgaact gaacggcact       420
     ccgggtaaat actctatgcc ggttccgatg atgaacatca tcaacggggg cgagcacgct       480
     gacaacaacg ttgacatcca ggaattcatg atccagccgg ttggcgcgaa aaccgttaaa       540
     gaagccatcc gtatgggttc tgaagttttc catcacctgg caaaagtgct gaaaggcaaa       600
     ggcatgaaca ccgcagtggg tgacgaaggc ggctatgcgc cgaacctggg ctctaacgct       660
     gaagcgctgg cggttatcgc tgaagcggtt aaagctgctg gctacgagct gggtaaagac       720
     atcaccctgg cgatggactg cgcagcatct gaattctaca aagacggtaa atacgttctg       780
     gctggcgaag gcaacaaagc gttcacctcc gaagaattca cccacttcct ggaagagctg       840
     accaaacagt acccgatcgt ttccatcgaa gatggtctgg acgagtctga ctgggacggt       900
     tttgcctacc agaccaaagt actgggcgac aaaatccagc tggttggcga cgatctgttc       960
     gtaactaaca ccaagatcct gaaagaaggc atcgagaaag gcatcgctaa ctccatcctg      1020
     atcaaattca accagatcgg ttctctgacc gaaactctgg ctgcaatcaa gatggcgaaa      1080
     gacgctggct acactgctgt catctctcac cgttctggtg aaactgaaga cgctaccatc      1140
     gctgacctgg ctgttggtac cgctgcaggc cagatcaaaa cggggtctat gagccgttct      1200
     gaccgtgttg ctaaatacaa ccaactgatt cgtatcgaag aagctctggg cgaaaaagca      1260
     ccgtacaacg gtcgtaaaga gatcaaaggc caggcgtaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page