(data stored in SCRATCH zone)

EMBL: CP000880.PE92

CP000880.PE92        Location/Qualifiers
FT   CDS_pept        90572..90823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00093"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG30285 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20046"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF94"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806483.1"
FT                   /protein_id="ABX20046.1"
FT                   /translation="MKIITHVVPGSDMAEIYDDIADNSRLIIKSKLRHVENDPKELLIC
FT                   VPTRSEWLFYWIKGDKHCARRRAYKNIKHYVSKIKPKN"
     atgaaaatca tcacacatgt agtaccaggt tcagatatgg ctgaaatata tgatgatatc        60
     gctgacaatt cacgccttat tattaaaagc aagttacgcc atgttgaaaa tgatccgaaa       120
     gagttgctga tatgtgtccc gacgcgtagt gagtggctat tttactggat taaaggagat       180
     aaacattgcg cccggcgacg ggcgtataag aacatcaaac attacgtttc caaaatcaaa       240
     ccgaaaaatt aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page