(data stored in SCRATCH zone)

EMBL: CP000885.PE105

CP000885.PE105       Location/Qualifiers
FT   CDS_pept        complement(142366..143478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0106"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region; KEGG: tte:TTE2692 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40496"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR017019"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:A9KQI7"
FT                   /protein_id="ABX40496.1"
FT                   /translation="MSKISFFSTTDAGITVISNRFLDEYMPRANGTFVKIYLYLLRCFQ
FT                   DPSLETSLSYLAEKLDETEKDIERAIRYWEKEQLLIITRAANRQITAITFTFPSNDNLN
FT                   TEETLPSITQEVMEQTAVTEAAAKEQDNSKATTIHKPNYSEAQIKALTEMEEVKWIMNT
FT                   VERLLERLLKSTDVQLILFLYESVGFSAELIFYLYEYCVSKNKRSASYIETVAISWAEE
FT                   GIDTVEKADAATLSYNNNYNSINKAFGLNRAPGTIEKKFMHRWFHEFCFDINIIEEACN
FT                   RTMLATGKPDFKYADKILENWYKKGVTCDADIVKLDEAHAKQSALSAANKQAASTKQPT
FT                   ANNRFNAFPQRKYSEEDFLSMEQRLLNNRS"
     atgagtaaaa tttctttctt ttcaaccaca gatgcaggaa tcactgtaat ttccaataga        60
     tttttagatg aatacatgcc acgtgccaat ggtaccttcg taaaaatata tctctatcta       120
     cttcgttgtt ttcaggatcc ttccttagaa acttcacttt cttacttggc tgaaaaatta       180
     gatgagaccg aaaaggatat tgaacgtgca atccgttatt gggaaaagga gcaattgctt       240
     attataacta gggcagcaaa tcgtcaaata actgctataa catttacttt tccatccaac       300
     gataatctaa atacagagga aactttgcct tctatcacac aagaggttat ggagcagaca       360
     gcagtaacag aggcagcagc gaaagaacag gataattcaa aagcaactac cattcataaa       420
     ccaaactact ccgaggcaca gatcaaagcg cttactgaga tggaagaagt gaagtggatt       480
     atgaatacag tagaacgatt gttagagcgt ttattaaaat caactgacgt tcaattaatt       540
     ctgtttttat atgaaagcgt tggattttcc gctgaattaa tcttttatct ctatgagtac       600
     tgcgtatcaa agaataaaag gagtgcaagc tatatcgaga cggtagcgat ttcctgggca       660
     gaagaaggaa ttgacactgt tgaaaaagct gatgctgcaa cactttctta caacaataat       720
     tataattcca tcaacaaggc atttggttta aatagagctc caggaactat tgaaaaaaag       780
     tttatgcatc gttggtttca tgagttttgc tttgatatta atattataga ggaagcttgt       840
     aatcgtacca tgttagcaac agggaaacca gactttaaat atgctgacaa aatacttgag       900
     aactggtata aaaagggagt cacctgcgac gctgatattg taaaattaga tgaagcacat       960
     gcaaaacaat ccgccctttc cgcagcgaat aaacaagctg catccacaaa acaacctact      1020
     gcaaacaacc gatttaatgc atttcctcaa agaaagtact ccgaagagga ttttctctca      1080
     atggagcaac gtcttttaaa taatcgttca taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page