(data stored in SCRATCH zone)

EMBL: CP000885.PE116

CP000885.PE116       Location/Qualifiers
FT   CDS_pept        158002..159138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0118"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: cbe:Cbei_2871 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   CBS domain containing protein; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40507"
FT                   /db_xref="GOA:A9KR39"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR39"
FT                   /protein_id="ABX40507.1"
FT                   /translation="MIKFTNITKSFKSNKILKDVTFNIDTGNLVAIIGESGCGKTTLLK
FT                   MINRLIKPTSGSISIDGEDILSLDEVSLRRKIGYVIQQTGLFPHMTIKENIEIIPKILK
FT                   VDSAEIMENTKKLMNMVGLDYENFIDRYPSELSGGQQQRVGVARAFANNPDIILMDEPF
FT                   SALDPMTRSDLQDELVELQSKLKKTIVFVTHDMDEAIKIADKICIMREGRVLQYDTPEN
FT                   ILKNPVDDYVSNFVGKNRIWSSPEFIKVHDFMMNKPVTATKDLSILKCIDKMRQKKVDS
FT                   LLIINPDNHHLHGILKASQIRSIGDRTQSAENFMVTDFPTLNPDNTIVDALKLVTEQKV
FT                   STIPVTKEDGYLVGLVTRGNLVTTLSQQYYNGDEEVDV"
     atgattaaat ttactaacat aacaaaaagt tttaagtcta ataaaatact aaaggatgtt        60
     actttcaaca ttgatactgg taacttagtg gcaatcattg gtgaaagtgg ttgtggaaaa       120
     acaacattgc taaaaatgat aaatcgactc atcaagccaa cgagtggctc tatttcaatt       180
     gatggtgaag atattctatc tttagatgag gtatcgttac gaaggaagat tggttatgta       240
     attcagcaaa caggattatt tccacatatg acgattaaag aaaatataga gattatacca       300
     aagattctta aagtagattc tgcagaaatt atggaaaata caaagaaatt gatgaacatg       360
     gtaggccttg attatgagaa ttttattgac cgatatccat cagaattaag tggaggacag       420
     cagcaaagag ttggtgtggc gagggccttt gctaataacc ctgatattat attaatggat       480
     gagccatttt ctgcacttga tccgatgacg aggtctgatc tacaagatga attagtagaa       540
     ttacaatcta agttaaagaa aacgatagtt tttgttacac atgatatgga cgaagcgata       600
     aagatagcag ataagatatg tattatgaga gaaggacgcg tacttcaata cgacacgcca       660
     gaaaatatct taaaaaatcc agttgatgat tatgtctcaa acttcgtagg taaaaaccga       720
     atttggtctt ctccggaatt tatcaaagtg catgacttta tgatgaataa accagttaca       780
     gcaacaaaag atctctcaat tttaaaatgt attgataaaa tgcgccaaaa aaaggttgat       840
     agccttctaa ttattaatcc agataatcat catttgcatg gcattttgaa agctagccag       900
     ataaggagta ttggagatag gacacaatct gcagaaaact tcatggttac agacttccca       960
     acattaaatc ccgataatac catagttgat gcattaaagt tagtaacaga acaaaaagtt      1020
     tcaacaattc cagttaccaa agaggatgga tatttggttg gtttagtaac tcgtggtaat      1080
     ttagttacca cactaagtca gcagtactat aacggtgatg aggaggtgga tgtatga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page