(data stored in SCRATCH zone)

EMBL: CP000885.PE134

CP000885.PE134       Location/Qualifiers
FT   CDS_pept        178585..179220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_0170 spore cortex biosynthesis
FT                   protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40525"
FT                   /db_xref="GOA:A9KR57"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR57"
FT                   /protein_id="ABX40525.1"
FT                   /translation="MLMNTSIFLELRYLAAASYWGIILFLIYDLLRILRNTFHHGKIVI
FT                   GIQDICFWIVAGILIFRMMYLQNDGMIRWYSTVAMVLSMVLYQKIFSPLIVGGGTKFTL
FT                   FIKNCILRLLKLLVSPIMFIISKIKKLFRFLFGKVRKFGRFLGGKVKKRTNIFKACIRK
FT                   QLKKHLNKVKIKKRKQVEEAPPPKVERPRGVLELITQPQEKGEVSEKE"
     atgcttatga atacatccat ctttctagaa cttcggtatc ttgcagctgc atcctattgg        60
     ggaatcatat tgtttttaat atatgacttg cttcgaatac ttaggaatac ctttcatcat       120
     ggaaaaatag tgattggcat acaggatatt tgtttctgga ttgtggcagg cattttgatt       180
     ttccgaatga tgtatttgca aaatgacgga atgattcgat ggtacagtac agttgcaatg       240
     gttcttagta tggttttgta tcaaaagatt tttagtccac tgattgttgg aggcggtaca       300
     aagtttacac tatttattaa aaattgtata ttgcggttat taaaactatt agtttcaccg       360
     ataatgttta taatatctaa aataaaaaaa ttatttcgat ttctttttgg gaaagtccga       420
     aaatttggac gttttcttgg aggaaaagtc aaaaaaagaa ctaatatttt caaggcttgt       480
     attagaaaac aattgaaaaa gcacttgaat aaggttaaaa taaagaaaag gaaacaagtg       540
     gaggaagctc ctccgccaaa agtagaacgt ccacgtggtg tattagaatt aattacacag       600
     ccacaggaaa agggtgaggt aagtgagaag gaataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page