(data stored in SCRATCH zone)

EMBL: CP000885.PE145

CP000885.PE145       Location/Qualifiers
FT   CDS_pept        191877..192836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0147"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: csc:Csac_1552 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40536"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR68"
FT                   /protein_id="ABX40536.1"
FT                   /translation="MKMKQNVLMTVLLCLMVIICVGCNNEAPPKEQDHSLDGALLDVTP
FT                   SISPESVTATPNADFISEEGKETITENTTPLKPGNVEIDANAILGQFTTHFYNSSKARK
FT                   NNIVNAAKKIHLKVVNPGEVFSTVGAISPITKDNGYDDAGTYQDGRVVNAIGGGVCQVS
FT                   TTLYNAVLGAELKVTERHPHSMTVSYVELGRDAAIAGDYMDFCFQNTLETPIVIEAIAD
FT                   PAGSITVRIRGVETRDKSKRKVSYESVILETIEPGPAVITYDKNQPKNYLKVTQSAHSG
FT                   YKVELYRLIYYQGELIDRILLNTSTYEAAPQYLTIGIK"
     atgaaaatga aacaaaatgt ccttatgacc gtactactat gtttgatggt aataatttgt        60
     gtaggatgca ataatgaggc cccaccaaag gaacaggatc attctttgga tggggcttta       120
     cttgatgtaa caccttccat atcaccagag tcggtaacgg caacaccaaa cgccgatttc       180
     atttcggagg aagggaaaga aacgattacg gagaatacaa ctccattaaa gccaggaaat       240
     gtagaaatcg atgccaatgc aattttgggg caatttacaa ctcattttta caactcatcg       300
     aaagcaagaa aaaataatat tgttaatgca gcgaagaaaa tacatcttaa agttgtaaac       360
     ccaggagagg tattttcaac tgttggtgct atttctccta ttacaaagga taatggttat       420
     gatgatgcag gtacctatca agatggtaga gttgtcaatg ctattggtgg aggagtttgc       480
     caagtgtcca ctacacttta caatgcagta cttggggctg aattaaaagt aacagaacgg       540
     caccctcact ccatgacggt aagttatgtg gaacttggta gagatgcagc tatcgctggt       600
     gattatatgg atttttgttt tcaaaataca ttagaaacgc ccattgtaat tgaagcaatt       660
     gcggatccag ctggtagtat aacagtacgg atccgtggag ttgaaacaag agataaaagt       720
     aagcgaaaag tttcttatga atccgttatt ctcgaaacaa ttgagccagg gcctgcagtt       780
     ataacttatg ataaaaatca accaaaaaat tatttgaaag ttacacagtc tgctcatagt       840
     ggttataaag ttgaactata ccgtttaatc tactaccaag gagagcttat cgaccgtatt       900
     ttattaaata ctagtacgta tgaggcagcc ccacaatatt taaccatagg aattaaatag       960
//

If you have problems or comments...

PBIL Back to PBIL home page