(data stored in SCRATCH zone)

EMBL: CP000885.PE16

CP000885.PE16        Location/Qualifiers
FT   CDS_pept        27208..28647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0016"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: amt:Amet_1507
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40407"
FT                   /db_xref="GOA:A9KPQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ6"
FT                   /protein_id="ABX40407.1"
FT                   /translation="MKNRAVEKIRSVLRKVILPYRKKKEAMLGGIRLSITNRIAMNYMK
FT                   LLIINGFLFFFVFSILYLNIEKGRYEDLAEEIVVNLENDGDAFLTVVNPYSKLGVNMIL
FT                   YEVDTGREVYNDVTYDVKNYRRIFRSIHYTKSSDTHRLILDDDMEFVQGGTLYRAQFFY
FT                   NMTKDYNRMWSLLWNMLILYVIIVFFIIQEGKKNNIKLLEPIQSMSATVNRLTVSNLHS
FT                   ERLNVAGTKNELKDLAIVFNNMLDRLETSYDRQKQFVSDASHELRTPIAVIQGYINMLS
FT                   RWGSKDQEILEESIEAIKNEAKAMQDLVEKLLFLSRHDKKTLKLEKKIFNMRPIVEEMV
FT                   KETKLVTANRVIEAPYLEDVNVYGDKQALKQAIRVFIDNAVKYTQDGDTIRIYCRNIRG
FT                   DCMIGVEDTGIGMTRKDMDNIFNRFYRSDHVRDRKIEGHGLGLSIAKLIIMAHTGRIKV
FT                   RSQFTKGTSFIVTIPRIRYDS"
     atgaaaaata gagctgttga aaagatacgt agtgtattaa gaaaagttat actaccatat        60
     cgtaaaaaaa aggaagccat gttgggagga attcgtctct ctattaccaa ccgtatcgcc       120
     atgaactata tgaaactatt aattattaat ggctttctat tcttctttgt attttctatt       180
     ctttatttga atatagaaaa aggaagatat gaggacctgg cagaagaaat tgttgttaat       240
     ttggagaatg atggagacgc ttttttaacc gtagtaaatc cctattcaaa gctaggtgtt       300
     aatatgattt tgtatgaagt cgacacaggg cgagaggtat acaatgatgt tacttatgat       360
     gtaaaaaatt acagacgtat ctttcgctca attcactata caaaatccag tgatacacat       420
     cgtcttattc tagatgatga tatggaattt gttcaaggag gaacattata ccgagcacag       480
     tttttttata atatgacgaa agactataat cgtatgtggt ctttgctatg gaatatgtta       540
     atcttatatg ttataatcgt attctttatt atacaagaag gtaagaagaa caatattaaa       600
     ctccttgagc caattcaatc catgtctgcg acagtaaatc gtttgacagt gagtaatctt       660
     catagtgagc gattaaatgt agcaggaaca aagaatgaac taaaggactt agctattgtt       720
     tttaataata tgctagaccg attagagaca tcatatgata gacagaaaca atttgtatcg       780
     gatgcttccc atgagcttcg aactccaatt gcagtaattc aaggatatat taatatgtta       840
     agcaggtggg gttccaagga tcaagagata ctagaggaat cgattgaagc tataaaaaat       900
     gaagcgaaag ccatgcagga tttagtggaa aaattattat tcctctcaag gcatgataag       960
     aagacactaa agctagagaa aaagatattt aatatgagac caatcgttga ggaaatggta      1020
     aaagaaacaa aacttgtaac tgcgaaccga gtaattgaag caccttacct ggaagatgtt      1080
     aatgtatatg gcgataaaca ggctctaaaa caggcaatta gggtatttat tgataatgca      1140
     gtaaaataca ctcaggatgg agatactatc cgtatttatt gccgtaacat tcgtggtgac      1200
     tgtatgattg gtgttgagga taccggtatt ggtatgacaa gaaaagatat ggataacatc      1260
     tttaaccgat tttatcgttc tgatcatgtc cgtgatcgaa agattgaggg tcatggattg      1320
     ggattatcca ttgcaaagct tattattatg gcacatacag gtaggatcaa ggtacgttct      1380
     cagtttacta aaggaacaag ttttatcgta acgattccaa gaatacgcta tgatagttaa      1440
//

If you have problems or comments...

PBIL Back to PBIL home page