(data stored in SCRATCH zone)

EMBL: CP000885.PE171

CP000885.PE171       Location/Qualifiers
FT   CDS_pept        complement(220274..222049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0175"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: smu:SMU.515 putative 67 kDa
FT                   myosin-crossreactive streptococcal antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40562"
FT                   /db_xref="GOA:A9KR94"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR94"
FT                   /protein_id="ABX40562.1"
FT                   /translation="MYYSSGNYEAFARPVKPEGADRKSTYLIGSGLASLSAACFLVRDG
FT                   QLKGERIHILEKDKLPGGACDGYKYSDRGFVMRGGREMDNHFECMWDIMRSIPSIETEG
FT                   VSVLDEYYWLNKSDPNYSLMRATVNRGEDAHTDGKFGLSDKGAMEIMHLFFTPDEELFE
FT                   KRIDELFSKEVLNSNFWMYWRTMFAFENWHSALEMKRYIQRYIHHIGGLPDFKALRFTK
FT                   YNQYESLILPMMKYLEEHNVQFHYDTQVVNVEFDIKKDKKVAKRIVCIHENQEESIDLS
FT                   EDDLIFISNGGCVENSSLGDQNHTAEYNTEIKAGSGWDMWRKIAAQDPSFGNPDKFCGD
FT                   PEKTNWMSATVTTLDDKIPPYVQNICKRDPFSGKVVTGGIVTATDSNWLLSWTFNRQPQ
FT                   FRNQPKNQLVGWIYGLFSDVPGNFVKKTMRECTGKEICMEWLYHMGVPENQIEQLAENS
FT                   ANTVPCMMPYITAFFMPRNTEDRPLVVPEGSVNFAFIGQFAETKRDTIFTTEYSVRTGM
FT                   EAVYTLLDIDRGVPEVWGSVYDVRDLLNASVQLTDGKKITDVDLGFKGKMALKEGLKKL
FT                   KDTEIEKLLKEYNVI"
     atgtattata gcagtggtaa ttatgaagca tttgcacgac cagtaaaacc agaaggtgct        60
     gatcgtaaat caacttattt aattggttct ggacttgcat ctttatcagc agcttgcttt       120
     ttggtaagag atggtcagtt aaaaggagaa cgtattcaca tacttgaaaa ggataaactc       180
     cctggcggcg cctgcgatgg ttataaatac tctgaccgtg gtttcgttat gcgtggaggc       240
     cgagaaatgg ataaccattt tgaatgcatg tgggatatca tgagatccat tccttcgatt       300
     gaaacagaag gtgttagtgt tttagatgaa tattactggt taaataaaag tgacccaaac       360
     tattccctta tgcgtgctac cgtaaaccgc ggagaagatg cacatactga tggtaagttt       420
     ggtttatccg ataaaggtgc tatggaaatt atgcatctat ttttcacacc agatgaagag       480
     ctatttgaaa aacgtattga tgaattattc tctaaggaag tattaaactc aaacttttgg       540
     atgtactggc gtactatgtt cgcctttgaa aactggcata gtgcccttga gatgaaacgt       600
     tatatccagc gttatattca tcacattgga ggtctaccag actttaaagc acttcgtttt       660
     acaaagtaca atcaatatga atcactaatc cttccaatga tgaagtatct agaagaacat       720
     aatgttcagt tccattatga tacacaggta gttaatgtgg aatttgatat caaaaaagat       780
     aaaaaggttg ctaaacgtat tgtttgtatt catgagaatc aggaagaatc cattgattta       840
     agtgaagatg atcttatatt tatcagcaat ggtggctgtg ttgaaaattc ttctttaggc       900
     gatcaaaatc atacagctga gtataatacc gaaataaaag caggcagtgg ctgggatatg       960
     tggcgtaaga ttgcagcaca agacccatcc tttggtaatc cagataagtt ctgtggtgat      1020
     ccagaaaaaa caaattggat gtctgccaca gtaactacac tagatgataa aattcctcct      1080
     tatgttcaaa acatctgtaa gcgtgatcca tttagcggca aagttgttac tggtggtatt      1140
     gttacagcaa ctgactctaa ctggcttctt agctggacct ttaaccgcca gccacagttt      1200
     agaaatcagc caaagaatca attagttggc tggatctatg gattatttag tgatgtacca      1260
     ggtaactttg tgaagaaaac aatgcgcgaa tgtactggta aagaaatctg tatggaatgg      1320
     ttataccata tgggagttcc tgaaaatcaa atcgaacaac tcgcagaaaa tagtgcaaac      1380
     actgttcctt gtatgatgcc ttatatcaca gctttcttta tgccacgtaa cactgaggac      1440
     cgtcctttgg ttgttccaga aggaagcgta aactttgcat ttattggaca atttgctgag      1500
     acaaaacgtg atactatatt tacaaccgaa tattctgtac gtaccggtat ggaagctgta      1560
     tataccttac ttgatataga ccgtggcgta ccagaagttt ggggtagcgt ttatgatgtc      1620
     cgcgatttat taaatgcatc cgttcaatta acagatggta aaaagattac cgatgttgat      1680
     ttaggattca aggggaaaat ggcgttaaag gaaggactta agaagttaaa agatactgaa      1740
     atcgaaaaac ttcttaagga gtataatgta atataa                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page