(data stored in SCRATCH zone)

EMBL: CP000885.PE173

CP000885.PE173       Location/Qualifiers
FT   CDS_pept        223270..223944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0177"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   cte:CT0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40564"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR96"
FT                   /protein_id="ABX40564.1"
FT                   /translation="MDRKVSLSEISDGKLYGLNDMVKAGCNDCKGCSACCKGMGKSIIL
FT                   DPFDIFRFTTNLGKSFEELLNDKIELNIVDGVILPNLKMVGESESCAFLNNEGRCSIHA
FT                   NRPGICRIFPLGRYYEDHAYQYILQIHECKYKNRSKVKVSKWIDTNDSKRNEQFIIDWH
FT                   YFLKDLQEQIKKSADSTWIRNINLYLLNAFYQKPYVKDKDFYLQFEERLELMKSYLVSL
FT                   ER"
     atggatagaa aagtcagttt aagtgaaatc tccgatggaa agttgtatgg attaaatgat        60
     atggtgaaag caggatgtaa tgattgtaaa ggatgttctg cttgttgtaa ggggatggga       120
     aaatctatta tattagaccc atttgatatc tttcgattca caactaatct tgggaaaagc       180
     tttgaggaat tactaaatga taaaattgag ctaaatattg tagatggggt tatcctaccg       240
     aatcttaaga tggtagggga atccgaaagt tgtgcttttc ttaataacga gggaagatgt       300
     agtattcatg cgaatcgccc aggaatttgt agaatattcc cgcttgggag atattatgaa       360
     gatcatgcgt accaatacat actacaaatt catgaatgta agtataagaa tcgttccaaa       420
     gtcaaggtga gcaaatggat tgacacgaac gattccaaaa gaaacgaaca gtttattatc       480
     gactggcatt atttcttaaa agacttacag gagcaaataa aaaaatcagc agattctact       540
     tggataagaa atataaactt atatttgtta aatgcctttt atcaaaagcc ttatgtgaaa       600
     gacaaagatt tttatttaca atttgaagag cgattggagc taatgaaaag ttatctggtt       660
     tctttggaaa gataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page