(data stored in SCRATCH zone)

EMBL: CP000885.PE188

CP000885.PE188       Location/Qualifiers
FT   CDS_pept        complement(238298..240091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0192"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: ppe:PEPE_1650
FT                   ABC-type antimicrobial peptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40579"
FT                   /db_xref="GOA:A9KRB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB1"
FT                   /protein_id="ABX40579.1"
FT                   /translation="MLQVNHVTKKYGNAIILENSSYTFPSKGIVCLMGASGGGKTTLLN
FT                   LLAGFDTDYEGEILVGGTLISGMDAEKLCQYRRDNIGFVFQNYHLLPGYTASENVLLAS
FT                   ALSKDSPDASRQKAATLLTRLGIGEKENQKVENLSGGQKQRVAIARALMSDPQIIFADE
FT                   PTGALDRTTSTEIMKLLQEISRDRLVVVITHDAKICEFADEIIHIKEKKIIEERVIRRD
FT                   VTDEKALVVGSSPKISIFSRAVKNFKVHLTRYAAVSLSISIGLLAFLFSLSFGNVMERS
FT                   IDDFKTKNTAFNNGYIKGADDGTILEYLKKDERIENVYYQYKLRNLTLSTGDKSEQIAE
FT                   KFPTPKATESLSYGVMPRLGQNEIAITPSLAKKFDSDIKKLLGKEFILELDGQKHKLTM
FT                   SGIYNAGYDDFIVSSDIEQQFYKNITDEKNYSISYDVKEFSDIVGVSNVLKLRGITAKT
FT                   ASDEVYALQNTFHSLNKLFLVISFLILAISLFICTILLNKLQNTRYHEIGLLSALGFSR
FT                   QQISSMIRCENLLLSSLATVVNLILLFASILLGKLLDFALIFTGAQVVLSIVATFAIVM
FT                   LLSAVASYKLIRTEPAIALKK"
     atgttacaag taaatcatgt gacaaaaaaa tatggaaatg ccattatatt agaaaacagt        60
     agctatacct ttccttccaa aggtatcgtg tgcctaatgg gtgcgtctgg tggtggtaaa       120
     accaccctgc ttaaccttct tgctggattc gatactgatt acgaaggaga aatcctggta       180
     ggaggcacat taattagcgg aatggacgct gaaaagctct gtcagtatcg ccgggataac       240
     atcggctttg tgttccaaaa ttatcacctg cttccaggtt ataccgcatc ggaaaatgtg       300
     ctacttgcat ccgcactgtc gaaagattct ccagatgcta gccgacaaaa agccgcaaca       360
     cttttaacgc gactaggaat tggagaaaag gaaaatcaaa aagtggaaaa cctctctggc       420
     gggcaaaagc aacgtgttgc gatcgccagg gccttgatga gtgacccgca aatcatattc       480
     gctgatgagc ctaccggtgc tcttgaccgc acgacctcaa cagaaattat gaagctgctg       540
     caagaaatat ctagggacag acttgttgtg gtaattactc acgatgcaaa aatttgcgaa       600
     tttgccgatg agatcattca cattaaggag aaaaaaatca tagaggagcg ggtaataaga       660
     cgcgatgtga cagacgaaaa agcgttggta gtcggttcgt cgcctaagat ttctatattc       720
     tctcgcgctg tgaaaaactt taaggtgcac ttaacgcgtt atgctgcggt atctctctct       780
     atctccattg gcttacttgc cttcctgttt tctctatcct ttggcaatgt gatggaacgc       840
     tctatcgacg actttaagac caagaacacc gcctttaata atggctatat caagggtgcg       900
     gacgatggta caatactcga atatcttaag aaggacgaac gcatcgaaaa cgtgtattat       960
     cagtataagc ttcgtaatct cactttatcg acaggtgata aatcagagca gatagcggag      1020
     aagtttccga cgccaaaagc gaccgagagc ttatcttatg gtgtgatgcc tcgtctcgga      1080
     caaaatgaga ttgcaatcac accaagcctt gctaagaaat ttgattcaga cattaagaaa      1140
     cttctaggaa aagagtttat attagaactg gatggacaaa aacataagct tactatgagt      1200
     ggaatctata acgctggcta tgatgatttt attgtcagct ctgatattga gcaacaattt      1260
     tataaaaata ttacggatga aaaaaactat tctattagct atgatgtcaa ggaattttcc      1320
     gatatcgtag gggttagcaa cgtcctaaag ttacggggaa tcactgccaa aacggcctct      1380
     gacgaggtgt acgcgctaca aaacacgttt cacagtctta ataaattatt tcttgtgatt      1440
     tcctttttga ttttggcaat tagtttgttc atctgcacta ttttgctgaa caagctacaa      1500
     aacactcgtt atcacgaaat aggactgttg tcagctcttg ggtttagcag acagcaaatc      1560
     agctcgatga ttcgatgtga aaatttgttg ctgtcctccc tcgccacagt agtaaacctc      1620
     attctccttt tcgccagcat attacttggt aaactgcttg atttcgcgct gatttttaca      1680
     ggagcgcagg tcgttttatc catagtggct acctttgcca ttgttatgct tctaagtgct      1740
     gtagcgagct ataagttaat acgtaccgag ccagcgatag cactgaaaaa gtga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page