(data stored in SCRATCH zone)

EMBL: CP000885.PE196

CP000885.PE196       Location/Qualifiers
FT   CDS_pept        complement(247133..248617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0200"
FT                   /product="L-fucose isomerase related protein"
FT                   /note="KEGG: cac:CAC2610 L-fucose isomerase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40587"
FT                   /db_xref="GOA:A9KRB9"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRB9"
FT                   /protein_id="ABX40587.1"
FT                   /translation="MNNIPNINVGIVAVSRDCFPMSLSNRRREAVVSSYREKGLEIYEC
FT                   PITIENEKDMLKALADVKAANCNALVVYLGNFGPESSETLLAKNFDGPVMFAAAAEETT
FT                   SILADERGDAYCGMLNASYNLKLRNIRAYIPEYPVGTPTEVATMIEDFLPIARTIIGLQ
FT                   NLKIISFGPRPQDFLACNAPIKALYSLGVEIEENSELDLFASFNDHANDPRIPDVIKDM
FT                   EEELGTGNNMPGILPKLAQYELTLLDWAEAHKGCKEFVVFANKCWPSFQTQFGFVPCYV
FT                   NSRFASKGMPVSCEVDIYGALSEYLGVCVSEDSVTLLDINNTVPADMYDASIKGKFDYK
FT                   PTDTFMGFHCGNTPSKKLSSCSMKNQKIMARSLEPNQEPNITRGTLEGDIAPGEITFFR
FT                   LQSTADTVLRAYVAEGEVLPVPTQSFGSIGVFAIPEMKRFYRHVLVEKNYPHHGAVAFG
FT                   HFGKAIFEVFKYFDVADIEFNRPASMMYPTENPFYR"
     atgaataaca ttccaaacat taatgtcggc attgttgccg taagtagaga ctgtttccct        60
     atgagtctct ccaacagaag aagagaagct gttgtttcct cttatcgcga aaaagggctt       120
     gaaatttatg aatgtccaat cacgattgaa aatgagaaag atatgttaaa agcacttgct       180
     gatgtaaaag cagcaaattg taatgctctc gttgtttacc ttggtaactt tggtccagaa       240
     agcagcgaaa cattattagc aaagaatttt gatggtcctg ttatgtttgc tgcagctgca       300
     gaggaaacta cctctatact tgcagatgaa cgtggcgatg catactgtgg tatgttaaat       360
     gcaagctata acttaaagtt acgtaatatc cgtgcataca taccagaata tccggttggt       420
     acaccaactg aggttgctac tatgattgaa gatttcttac caatcgctcg tacaattatc       480
     ggtttacaga acttaaagat tatctccttc ggtccaagac ctcaggattt ccttgcttgt       540
     aatgctccaa tcaaagcgtt atacagccta ggtgttgaaa ttgaagaaaa ctctgagctt       600
     gacttattcg catcatttaa cgatcatgcc aatgatccac gaattccaga tgtgataaaa       660
     gatatggaag aagaacttgg tactggaaat aatatgcctg gcatccttcc taagcttgca       720
     cagtacgagc ttacattact tgactgggca gaggctcaca agggttgtaa agagtttgtt       780
     gtattcgcta ataagtgctg gccttccttc cagactcagt ttggtttcgt accatgttat       840
     gtaaacagtc gttttgcaag taagggtatg ccagtctcct gtgaagttga tatctatggt       900
     gcattaagtg agtaccttgg agtttgtgtc agtgaagatt ccgttactct tcttgatatt       960
     aacaacactg taccagctga tatgtacgat gcttctatca aaggcaagtt tgactataag      1020
     ccaaccgata ccttcatggg cttccactgt ggaaatacac catctaagaa attatcctcc      1080
     tgttctatga agaatcagaa gattatggct agaagccttg agccaaatca ggaaccaaac      1140
     atcacaagag gtaccttaga gggtgatatc gctccaggtg aaatcacatt ctttcgtctt      1200
     caaagcactg ctgatactgt attacgtgct tatgttgcag aaggtgaagt acttcctgtt      1260
     ccgactcagt cttttggtag catcggtgta tttgctattc cagagatgaa gcgtttctac      1320
     cgtcatgtat tagtagaaaa gaattaccct catcacggag ctgttgcatt cggacatttc      1380
     ggtaaggcaa tttttgaagt atttaaatac tttgatgtag ctgatattga atttaataga      1440
     ccagcctcca tgatgtatcc aacagaaaat ccattctaca gataa                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page