(data stored in SCRATCH zone)

EMBL: CP000885.PE223

CP000885.PE223       Location/Qualifiers
FT   CDS_pept        complement(282192..283226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0227"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: amt:Amet_1262 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40614"
FT                   /db_xref="GOA:A9KRY3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY3"
FT                   /protein_id="ABX40614.1"
FT                   /translation="MLTVNENREFDALALGEILLRLSAPSNERIVRGDTFEKCAGGAEL
FT                   NVVSGISMMGLRTGIISKVPQNDIGTYVKNHLRFCGVSDDCLIFDESRDARLGIYFYEN
FT                   GAYPRKSSVVYDRRNSSINTISMDDIPESTFSSTKLFHTCGITLALSPQTRDVTEECIK
FT                   KFKEQGALISFDVNYRANLWDEATAKEYIERILPYVDILFVSEETSRRTFGKTGTIKEI
FT                   MKSYTEDFNIKIVATTERIVISPKKHTFGSTIYNAVEDKFYEEAPYQNIEVIDRIGSGD
FT                   AYVSGVLYGLLAYDDCQKALEIGNAASAVKNTIPGDLPSTDLKEIQKIISSHQNIGPQS
FT                   EMNR"
     atgctgacgg ttaatgaaaa tcgcgaattt gacgcacttg ctttaggaga gatcttatta        60
     agactttctg ctccctccaa tgagcgtatt gtacgtggag atacatttga aaaatgcgct       120
     ggtggcgcgg aattaaatgt tgtatctgga atttctatga tgggacttcg tactggtatt       180
     atttcaaaag tcccacaaaa cgacatcggt acttatgtaa agaatcacct tcgtttctgt       240
     ggcgtcagtg atgactgcct tatcttcgat gaaagcagag acgctagact aggaatctat       300
     ttttatgaga atggagcata tcctagaaaa tcttctgtag tttatgacag acgaaactct       360
     tccatcaaca cgatttccat ggatgatatt ccagaaagca ctttctcatc caccaaatta       420
     ttccatacat gcggtattac cttagcacta tcccctcaaa ctagggacgt tacagaagag       480
     tgcattaaga agtttaaaga acaaggagcg cttatctctt ttgatgtaaa ttaccgcgca       540
     aacctttggg atgaagcaac cgcaaaggaa tacattgagc gaatcctccc atatgttgat       600
     atcttatttg tatccgaaga aacttctcgc cgaacatttg gcaaaaccgg tacaattaaa       660
     gaaatcatga aatcctatac cgaagatttt aatataaaaa ttgtagcaac aacagaacgt       720
     atcgtaatta gtccgaagaa gcataccttt ggttccacaa tatataatgc agtagaagat       780
     aaattctacg aagaggcacc atatcagaat atagaagtca ttgaccgcat cggaagtgga       840
     gatgcttatg tatctggtgt tctttacgga ttgttagcat atgatgactg ccaaaaggct       900
     cttgaaatcg gtaatgctgc aagcgcagtg aagaatacca ttcctggaga cttaccatcc       960
     actgatttaa aagaaataca aaaaatcatc tcctcccatc aaaacattgg gcctcagagc      1020
     gagatgaatc gttag                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page