(data stored in SCRATCH zone)

EMBL: CP000885.PE224

CP000885.PE224       Location/Qualifiers
FT   CDS_pept        283704..284357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_1184 endo alpha-1,4
FT                   polygalactosaminidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40615"
FT                   /db_xref="InterPro:IPR025648"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRY4"
FT                   /protein_id="ABX40615.1"
FT                   /translation="MRNKKLMALSLVAVLAFTACGKKETNEPTPTPTVAPTETPAATET
FT                   PTETPAEPGTDGSGEELGATELTSNETLDKIHEEVKAAYGDNYLPNMPFTVENLDEMFG
FT                   IKADWYDAAIAEGPMMSAHVDKLIGIHVTEGNLENVQNALNEYQKKIATDIQYPMNLPK
FT                   VQASVVETAGDYVFFVMLGTIDEMKYTEDSDMIKAFGEQNQIAVDIIKKNIEAK"
     atgagaaata aaaaattaat ggcattatct ttagtagcag tattagcatt cacagcatgt        60
     ggtaagaaag aaacaaatga accaacacct acaccaacag tagcaccaac agaaacacca       120
     gcggcaactg agacaccaac tgagacacca gcggaacctg gtacagatgg atctggagag       180
     gaattaggag caacagaact tacaagcaat gagactcttg ataagattca tgaggaagta       240
     aaggcagctt atggtgataa ttatcttcca aatatgccat tcactgttga aaacttagat       300
     gaaatgtttg gcataaaggc tgattggtat gatgcagcga ttgcagaagg tcctatgatg       360
     agcgctcacg ttgataaatt aatcggtatt catgtaacag aaggtaattt agagaatgta       420
     cagaacgcat taaatgaata tcagaaaaaa atagctactg atatccaata cccaatgaac       480
     ttaccaaagg ttcaagcttc tgtagttgaa acagctggag actatgtatt cttcgtaatg       540
     cttggtacaa ttgatgagat gaaatacaca gaagatagtg atatgattaa agcttttggt       600
     gagcagaatc agattgcagt agatattatt aagaaaaata ttgaagcaaa gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page