(data stored in SCRATCH zone)

EMBL: CP000885.PE234

CP000885.PE234       Location/Qualifiers
FT   CDS_pept        295200..296393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0238"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: amt:Amet_4480
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40625"
FT                   /db_xref="GOA:A9KRZ4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KRZ4"
FT                   /protein_id="ABX40625.1"
FT                   /translation="MGKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKTLHDRLGTGEA
FT                   VAFDKIDKAPEERERGITISTSHVEYESKARHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVAATDGVMAQTKEHILLSRQVGVPYIVVFMNKCDMVDDPELLELVEMEIRELLSEYE
FT                   FPGDDTPIIQGSALRALEDPNSQWGDKILELFDAVDTWIPDPQRATDKPFLMPIEDVFS
FT                   ITGRGTVATGRVERGVLHVSEEVEIVGVKEETRKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRTDIERGQVLCKPGTIKCYKKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVCNLPEGVEMCMPGDNIEMNIELIHPIAMEQGLGFAIREGGRTVGSGKVATIIG"
     atgggtaaag ctaagtttga aagaaacaaa ccacattgta atatcggaac catcggtcac        60
     gtagatcatg gtaaaacaac attaacagct gctatcacaa agacacttca tgacagatta       120
     ggtactggtg aagcagtagc atttgataag attgataagg ctccagaaga aagagaaaga       180
     ggtatcacaa tttctacttc tcacgttgag tatgagtcaa aagctcgtca ctatgctcac       240
     gttgactgcc caggccatgc tgactatgta aagaacatga tcactggtgc tgctcagatg       300
     gacggtgcta tccttgtagt tgctgctact gatggtgtta tggctcagac taaagagcat       360
     atcttacttt cccgtcaggt tggtgttcca tacatcgttg tattcatgaa caagtgtgat       420
     atggttgatg atccagaatt acttgaatta gtagagatgg aaatcagaga attattatct       480
     gagtatgagt tcccaggaga tgatactcca atcatccagg gttctgctct tagagctctt       540
     gaagatccaa acagccaatg gggtgacaag attcttgagt tattcgacgc tgttgatacc       600
     tggattccag atccacagag agcaactgat aagcctttct taatgcctat cgaggacgta       660
     ttctccatta ctggacgtgg tactgttgct acaggccgtg ttgagcgtgg tgttcttcat       720
     gtatctgaag aagttgaaat cgttggtgtt aaagaagaga ctcgtaaggt tgttgtaact       780
     ggtatcgaga tgttccgtaa acttcttgat gaggctcagg ctggtgataa catcggtgca       840
     cttttacgtg gtgttcagag aacagatatc gaaagaggtc aggttctttg taaaccaggt       900
     acaatcaagt gctacaagaa attcacagct caggtttacg tattaacaaa agacgaaggt       960
     ggacgtcata ctccattctt caataactat agaccacagt tctacttcag aacaactgac      1020
     gttactggtg tttgtaactt accagaaggc gtagagatgt gtatgcctgg agataacatc      1080
     gaaatgaata tcgaattaat tcacccaatc gctatggagc agggtcttgg attcgctatc      1140
     cgtgaaggtg gacgtactgt aggatcaggt aaggttgcta caattatcgg ctaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page