(data stored in SCRATCH zone)

EMBL: CP000885.PE235

CP000885.PE235       Location/Qualifiers
FT   CDS_pept        296631..297458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40626"
FT                   /db_xref="UniProtKB/TrEMBL:A9KRZ5"
FT                   /protein_id="ABX40626.1"
FT                   /translation="MNMQNKTVFHRKFGKGIIVDLNQNKLSVQFDAGKKIFVYPDAFRQ
FT                   FLVLMEKDGKSYVDGMLKELDRKEEISNRIARKMERHNQLIDKLKLHPSSQIVIRFVEN
FT                   DKATFLEDKIINTGLIQTGKTKGSPVRPSRLHQNSACILTERNEEEDESSRTIFGIAMV
FT                   EEDFLGTDCKDGKVTLHSQYVLLLPDHLQKLKFWNYYTDERYPEKLVWKSGEFRYCSNL
FT                   ISAQILKDIMSLPLENDAAALAEEFYHYFCEINQIEESTLPLPLGKLLEEGIK"
     atgaatatgc agaataaaac agtatttcat aggaagtttg gaaaaggtat tattgtcgat        60
     ctcaatcaaa acaaattatc cgtacaattt gatgcaggga agaagatatt tgtatatcca       120
     gatgccttcc gtcagttttt ggttctcatg gagaaggatg gtaagagtta tgtagacggt       180
     atgctaaaag aactggatag aaaagaagag attagtaatc gcatagctag aaagatggaa       240
     cgacataatc aactcattga taaactaaaa ctccacccaa gctcacaaat tgtaatacgt       300
     tttgttgaaa atgataaggc aacattttta gaagacaaaa taataaacac tggtttaata       360
     cagacgggaa agacgaaagg aagtccagtc agaccatcaa gattgcatca aaactcagca       420
     tgtattttaa ccgaacgcaa tgaggaagag gatgaatcaa gccgtactat ttttggaatt       480
     gcaatggttg aagaggattt cttaggtaca gattgcaaag atggtaaagt tacacttcat       540
     tcacaatatg ttttgttact accggatcat ttacaaaaat taaaattctg gaattactat       600
     acggacgaaa gatatccaga aaaattagtt tggaagtcag gagaatttag atactgttct       660
     aatcttatat ctgctcaaat cttaaaggat attatgagtc taccacttga aaatgatgct       720
     gctgcacttg cagaagaatt ttatcattat ttctgtgaaa ttaatcagat agaggaaagt       780
     acactcccat taccattagg taaattatta gaagaaggaa ttaaatag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page