(data stored in SCRATCH zone)

EMBL: CP000885.PE255

CP000885.PE255       Location/Qualifiers
FT   CDS_pept        320208..322196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0259"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: cth:Cthe_0309 excinuclease ABC, B subunit;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40646"
FT                   /db_xref="GOA:A9KS15"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS15"
FT                   /protein_id="ABX40646.1"
FT                   /translation="MDHFKLVSEFAPTGDQPEALEALVKGFEEGNQFETLLGVTGSGKT
FT                   FTMANVIQRLNRPTLIIAHNKTLAAQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVPST
FT                   DTYIEKDSAINDEIDKLRHSATAALTERRDVIIVASVSCIYGLGSPVDYQNMTLSLRPG
FT                   MIRDRDDVLRRLVEIQYTRNDMDFKRGTFRVRGDVVEIFPITGTDLAYRVEFFGDEVER
FT                   ITEIDVLTGEIKCTLEHMVIFPASHYVVSKDNLERAIVNIEEELEDRIRYFKSEDKLLE
FT                   AQRISERTHFDIEMLRETGFCSGVENYSMHLAGLTPESTPHTLIDYFPDDFLIMVDESH
FT                   ITIPQVRGMYAGDQSRKTTLVDFGFRLPSAKSNRPLNFTEFESKINQMLFVSATPNVYE
FT                   KDHELLRAEQIIRPTGLLDPVVEVRPVHGQIDDLVSEVNKETAKKNKVMITTLTKRMAE
FT                   DLTDYMRELGIRIKYLHSDIDTLERSEIIRDMRMDVFDVLVGINLLREGLDIPEISLVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNAEGRVIMYADRITDSMDKALRETERRRKIQDEY
FT                   NEKHGITPQTIKKKVRELISISKKVSKEMYDMNIKDYESMSRKELEAVAKKLTKEMHTA
FT                   AAELNFELAAELRDKLLELKKQINELE"
     atggatcatt ttaaattagt gtcggaattt gcaccgactg gagatcagcc tgaggcgcta        60
     gaggccttgg tgaaggggtt tgaagagggt aaccaatttg aaaccttact aggtgttact       120
     ggttctggta agacctttac gatggcgaat gtcatacaaa ggttgaatcg tcctacgtta       180
     atcattgcac ataataaaac gttagcagca cagttgtatg gtgagtttaa agaattcttt       240
     ccagagaatg cggtagaata ctttgtttct tattacgatt attatcaacc ggaggcttat       300
     gtgccatcaa cggatactta tatagaaaaa gactctgcta ttaatgatga gattgataaa       360
     ctgcgtcact cggcgactgc agcattgaca gaacgacgtg atgttattat agtggcatcc       420
     gtgtcttgta tctatggact tggtagcccg gttgactatc agaacatgac actttccctt       480
     cgtcctggta tgataaggga ccgcgatgat gtgcttcgcc gtcttgttga gattcaatat       540
     acaagaaatg atatggactt taaacgtggt actttccgcg ttcgaggtga tgttgttgag       600
     atatttccga ttactggaac agatttggca taccgagttg aattctttgg tgatgaggta       660
     gaacgtatta cagagattga tgttttaacc ggagagatta agtgtacgtt agagcatatg       720
     gttatctttc cagcatctca ttatgttgta tccaaagaca accttgagag ggcgattgtt       780
     aatattgaag aagagttaga ggatcgaatt cggtacttta agagtgagga caagctatta       840
     gaggcacaga gaatttcaga gcgtacccat tttgacattg agatgctccg agaaactggt       900
     ttttgttctg gagtagaaaa ctattcgatg catcttgctg gtttaacacc agagagtaca       960
     ccacatactc taattgacta ttttccagat gattttctga ttatggtaga tgagtcccat      1020
     attacaattc cacaggtacg aggaatgtat gcaggtgacc agtcaagaaa gactacctta      1080
     gttgattttg gtttccgtct tccatctgca aagagtaacc gaccattaaa ctttacggaa      1140
     tttgaaagta aaattaatca gatgctattt gtttctgcta caccgaatgt atatgagaaa      1200
     gatcatgagc tacttcgtgc agagcagatt atacgtccaa caggtctcct tgatcctgtt      1260
     gttgaggtta gaccggtaca tgggcagatt gatgatttag tttctgaagt gaataaggaa      1320
     actgcgaaga agaataaggt catgattact acgctgacta agagaatggc agaagattta      1380
     acggattata tgagagagtt aggtattcgt attaagtatc tacactctga tattgatacc      1440
     ttagaacgtt ctgaaattat ccgcgatatg cgtatggatg tatttgatgt attggttgga      1500
     attaacttat tgcgtgaggg tcttgatatc ccagagatca gcttagttgc gattcttgat      1560
     gcggataaag aaggattctt acgttctgaa acatcgttga tccagacgat tggacgtgct      1620
     gcccgtaatg cagagggtcg ggttattatg tatgcagaca gaatcaccga ttcaatggat      1680
     aaggcactga gggagacaga acgtcgtcgt aagattcagg acgaatacaa tgagaaacat      1740
     ggtattacgc cacagacaat taagaaaaaa gtacgtgaac ttatcagcat ttccaagaaa      1800
     gtaagtaagg aaatgtatga tatgaatata aaagactacg aatctatgag ccgcaaggaa      1860
     ttagaggctg tggcgaagaa attaacaaaa gaaatgcata cggcagcagc ggaattgaat      1920
     ttcgagcttg ctgcagagct tcgtgataaa ttgctagaat taaaaaagca aattaatgag      1980
     ttagaatag                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page