(data stored in SCRATCH zone)

EMBL: CP000885.PE256

CP000885.PE256       Location/Qualifiers
FT   CDS_pept        322207..325050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0260"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: cth:Cthe_0311 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40647"
FT                   /db_xref="GOA:A9KS16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS16"
FT                   /protein_id="ABX40647.1"
FT                   /translation="MADNKHFIKIRGAKEHNLKGISVDIPRDEFVVLTGLSGSGKSSLA
FT                   FDTIYAEGQRRYMESLSSYARQFLGQMEKPNVESIEGLSPAISIDQKSTNRNPRSTVGT
FT                   VTEIYDYFRLLYARIGIPHCPICGKEIKKQTVDQMVDEIMRLPEGTKLQLLSPVVRGRK
FT                   GEHTKIFEQAKKSGYVRVMVDGNLYELTEEIKLEKNKKHNIEIMVDRIVVKAGIEKRLT
FT                   DSVESVLKLSDGLLIVDVIGGEQLTFSQSFSCPDCGISMEEMEPRTFSFNNPFGACPEC
FT                   HGIGIKMEFAEELLIPDTSQSIDEGAIAAMGWASVTDKGSYTRATMEALSKEYDFSLST
FT                   PYRDYPDKVKYIIMHGTDGKTVKVHYQGQRGVGVYDVAFEGLIRNMERRYRETGSETQR
FT                   AEYETFMNTTPCKACKGKRLKREALAVTVGDRNIAEVTEISIRELHEFMNQLTLTSMQL
FT                   KIGELVLKEIRARIGFLMDVGLDYLTLARATGTLSGGEAQRIRLATQIGSGLVGVAYIL
FT                   DEPSIGLHQRDNDKLLKTLKHLKELGNTLIVVEHDEDTMFAADCIVDIGPGAGEHGGEV
FT                   VAVGTAQEIMDNPNSITGAYLSGRIKIPVPKVRKEPTGFLTIKGAKENNLRNVNVDIPL
FT                   GVMTCVTGVSGSGKSSLVTQILYKRLARDLNRARCIPGKHDDMIGIDKLDKVINIDQSP
FT                   IGRTPRSNPATYTGVFDQIRDLFAATPDAKMKGYSKGRFSFNVKGGRCEACSGDGIIKI
FT                   EMNFLPDIYVPCEVCGGKRYNRETLEVRYKGKSIYDILDMTIEEAVKFFENVPSIKRKI
FT                   ETLNDVGLSYLKLGHPSTSLSGGEAQRIKLATELSKRSTGKTIYILDEPTTGLHFADVH
FT                   KLVEILQRLSEGGNTVVVIEHNLEVIKTADYIIDIGPEGGDKGGTVIAKGTPEEIAKVK
FT                   ESYTGYYLKKYLEEVRE"
     atggctgata ataaacactt tatcaaaatc cgcggtgcca aagaacataa tcttaaggga        60
     atcagtgtgg atattccaag agatgaattc gttgttctta cgggacttag cggttcaggt       120
     aaatcctctc tcgcatttga taccatctat gcagaggggc aaagacgata catggaatca       180
     ttatcgtcat atgcaagaca gttccttggt cagatggaga aaccgaatgt ggaaagtatt       240
     gaagggttat ctcctgcaat ttccattgat caaaaatcta cgaatcgtaa cccaagatct       300
     acggttggaa cagtaacgga aatttatgat tattttcgtt tgctctatgc aagaatcggt       360
     attccgcatt gtcctatctg cggaaaggaa attaagaaac agaccgttga ccagatggta       420
     gatgagatta tgagattacc agaaggtacg aagttacagc ttctttctcc cgtagtacgt       480
     ggaagaaagg gtgagcatac aaagatattt gagcaggcaa aaaagagcgg ttatgtacgt       540
     gtgatggtag atggaaatct atatgaacta accgaagaga taaaactgga aaagaataaa       600
     aagcataata ttgaaataat ggtagaccgt atcgttgtaa aagctggtat tgaaaagcga       660
     ctgacagatt ccgtagagag tgtgctcaaa ttaagtgatg ggcttcttat agttgacgtt       720
     attggaggag aacagttaac attctctcaa agcttttctt gtccagactg tggtattagt       780
     atggaagaga tggagccaag aaccttctcc tttaataatc catttggagc gtgtccggag       840
     tgccatggta ttggtattaa gatggagttt gcagaagaat tactaatccc ggatacttca       900
     caaagtattg atgaaggtgc gattgctgct atgggctggg catccgtaac ggataaagga       960
     agttatacaa gagctacgat ggaagcgttg tcaaaagagt atgattttag tctaagcact      1020
     ccttatcgtg actatccgga taaagttaaa tatattatta tgcatggtac agatggaaaa      1080
     actgtcaaag ttcattatca agggcaacgt ggtgttggtg tctatgatgt ggcatttgaa      1140
     ggtttaattc gaaatatgga gcgcagatac cgcgaaactg gttcagagac acagcgtgcg      1200
     gaatatgaga catttatgaa tacgactcca tgtaaggcat gtaaaggaaa gagactgaaa      1260
     cgagaggctc ttgctgttac tgttggtgat aggaatattg cagaggtaac tgaaatttct      1320
     attcgtgaac ttcatgaatt catgaatcaa cttactttaa cttcaatgca attaaagatt      1380
     ggtgagctgg tattaaaaga aattcgtgct agaattggct tcttaatgga tgtaggtctt      1440
     gattatttaa cacttgccag agcaaccgga acattatccg gtggagaagc acagagaatt      1500
     cgtctggcaa ctcagatagg ttcaggatta gttggtgttg cctatatttt ggacgagcca      1560
     agtattggct tgcatcaaag agataatgat aaactcttaa agactctaaa gcatctgaaa      1620
     gagcttggga atacgctgat tgtagttgag catgatgaag acacaatgtt tgcagcagat      1680
     tgtattgtag atattggtcc tggtgcaggt gagcatggtg gtgaagttgt cgctgttggt      1740
     acagcacagg aaatcatgga caacccaaac tctattactg gtgcttactt aagtggaaga      1800
     attaagattc cagtaccaaa ggtaagaaaa gagccaacag ggttcttaac tattaaggga      1860
     gcaaaagaga ataatcttcg taatgtcaat gtagatattc ctcttggtgt gatgacctgt      1920
     gtaacagggg tatcgggatc tggtaagagt tccttggtaa cacagatttt atataaacgt      1980
     ttagcaagag atttaaatcg agctcgttgt attcctggaa aacatgacga tatgattggt      2040
     attgataagc ttgataaagt cataaacatt gaccagtcac caatcggacg tactcctaga      2100
     tctaaccctg ctacttatac tggtgttttt gatcaaatcc gtgatttatt tgcagcaaca      2160
     ccagacgcaa agatgaaggg atacagtaag ggacgcttta gttttaatgt taaaggcgga      2220
     cgttgtgaag cttgtagcgg tgatggtatc attaagatag agatgaactt cctaccagat      2280
     atctatgttc cttgtgaggt gtgtggtgga aaacgttata atcgtgagac attagaggtt      2340
     cgatataaag gtaagagtat ttatgatatt cttgatatga cgatagaaga agcagtgaag      2400
     ttctttgaga atgtaccttc cattaagaga aagattgaaa cccttaatga tgttggactt      2460
     tcttacttaa agcttggtca tccatcgact tctctttctg gtggtgaagc acagcgtatt      2520
     aagttagcca cagagttaag taagcgtagt actggaaaga caatctatat cttagatgag      2580
     ccaacaacag gtcttcattt tgcagatgtt cacaagttgg tagagatctt acaaagactc      2640
     tcggaaggtg gtaatacggt cgtagtcata gagcataacc tcgaagtgat taagactgcg      2700
     gactatatta ttgatattgg accagaaggt ggagacaaag gtggtactgt aattgcgaag      2760
     ggtactccgg aagagattgc gaaagtgaaa gaatcttaca cgggttatta tcttaaaaaa      2820
     tatctggaag aggtaaggga ataa                                             2844
//

If you have problems or comments...

PBIL Back to PBIL home page