(data stored in SCRATCH zone)

EMBL: CP000885.PE266

CP000885.PE266       Location/Qualifiers
FT   CDS_pept        338241..339011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_4627 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40657"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS26"
FT                   /protein_id="ABX40657.1"
FT                   /translation="MNSSIMKKLKYNNKPTYNKPSGYREYLREISDYSCEYCTITESEC
FT                   SGATFNIDHFRPKAYFPQYFSTCENLRYTCPRCNSYKNDKWIETEKGCIRNCEQCNNKA
FT                   CHENISRFIDNLYEDPQEVLELDDYGVLKAISGSNPADYTIKFLRLNRAQLIKLRKIRR
FT                   FIDLWNEELLAKRKEILLRNENLSLKIKRFDELKRHTFHSPKEECMLKIISTTLELLQI
FT                   QIDQELVLINDQLEKIEVLQKNRKISDDSFLNMI"
     atgaatagca gtattatgaa aaagctgaaa tacaataata aaccgacata taataaacca        60
     agtggatata gagagtatct cagggaaatt agtgattatt catgtgaata ttgtactata       120
     actgaaagtg aatgtagtgg agctactttc aatattgatc attttagacc caaagcgtat       180
     ttcccccagt atttttcgac ctgtgaaaat ttaagatata catgtcctcg ctgtaattcc       240
     tacaagaatg ataagtggat tgagacggaa aaaggatgta taagaaattg tgaacagtgc       300
     aataataaag catgccatga gaatatcagc agatttatag ataatttgta tgaagatccc       360
     caagaagtgc ttgagttaga tgattatggt gttttaaaag caataagtgg ttctaatcca       420
     gcagattata caataaaatt tcttaggcta aatagagctc aattaattaa attgagaaag       480
     attaggagat ttattgattt gtggaacgaa gaattattgg ctaagagaaa agaaatatta       540
     ttaagaaatg aaaatttatc attaaaaatt aaaagatttg atgagttaaa gcgtcataca       600
     tttcatagcc caaaagaaga atgcatgtta aaaattattt ctacaacact agagctctta       660
     caaatacaga tagatcagga gttggtttta attaatgatc aactagagaa gattgaggtt       720
     cttcaaaaaa atagaaaaat atcagatgat agcttcttaa atatgatata g                771
//

If you have problems or comments...

PBIL Back to PBIL home page