(data stored in SCRATCH zone)

EMBL: CP000885.PE267

CP000885.PE267       Location/Qualifiers
FT   CDS_pept        339345..339923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40658"
FT                   /db_xref="UniProtKB/TrEMBL:A9KS27"
FT                   /protein_id="ABX40658.1"
FT                   /translation="MESENINSEWNKQIVNHRQYNKICSKHGSVLVKSPNSKCRRCIEE
FT                   MKNNYNDLNHNGIVKIIEKLKNKYDVIMVPTYIPEGSVRWNGRRKNFENPLSEIYNLYY
FT                   FVYIKFCVNKEGVIRALVAGKTGSKKVNYSGSDINFFESVNHGEARKLLKEKNMKWYKD
FT                   EILVIKADDEDSAYRIENEVQECFNLFGS"
     atggagagtg aaaatattaa tagtgaatgg aataaacaga ttgtaaatca tagacaatat        60
     aataagatat gttctaaaca tggtagcgtc cttgtaaaat cacccaattc caaatgtcgt       120
     agatgtatag aagaaatgaa aaacaattac aatgatttaa accataatgg aattgtaaaa       180
     attatagaaa aactaaaaaa taaatatgat gttattatgg ttccaacata tataccagaa       240
     ggttctgttc gctggaatgg taggcgtaaa aatttcgaaa atccattatc agaaatatac       300
     aatttatatt attttgtata tattaagttt tgcgtaaata aggaaggtgt tattcgtgct       360
     ttagtggcag gaaagacagg ttcaaaaaaa gtgaattatt caggcagcga tattaatttt       420
     tttgaatctg taaatcacgg ggaagcacgg aaacttctaa aagagaagaa tatgaagtgg       480
     tataaggatg aaattttagt aataaaagct gacgatgaag attctgcata taggattgaa       540
     aatgaagtac aagagtgctt taatctattt ggaagttga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page