(data stored in SCRATCH zone)

EMBL: CP000885.PE297

CP000885.PE297       Location/Qualifiers
FT   CDS_pept        377579..378751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0301"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lmf:LMOf2365_1103 teichoic
FT                   acid biosynthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40688"
FT                   /db_xref="GOA:A9KSP4"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP4"
FT                   /protein_id="ABX40688.1"
FT                   /translation="MLRKIMKKGILAIYRILRFLPLQKRTICFMSNLGRSYGGNPKSIY
FT                   EEMVREGLDKEFRCIFFLEDTNAPIPGRVWKVKLSRFRYYYFLAVAGIWVSDTRFPNYI
FT                   KKRKGVTYLQTWHGTPLKKLALDMTSLVMAGEETLEQYKEEFKKNSATWDYLISQNPFS
FT                   TETFRRAFDFQGEILEYGYPRNDVLFQKNNSYDIDQIKKKLNIPRDKKIILYAPTWRDN
FT                   EYHDKANYKFNAPLDYNYLYEQLKDEYVILLKYHYMVREKLPLEQYRGFYMVVEQEIDI
FT                   SELYLVSDMLITDYSSVMFDYSLLYRPILFYVYDLKEYEDNLRGFYFDFVEEAPGPLFT
FT                   SSRELVSMVKNYYPEDYADKYKAFCDKYHTFENGNAAKRTVRLLSEKGMK"
     atgctacgaa aaatcatgaa aaaagggata ttggctatat acagaatcct aagattttta        60
     ccactccaaa agagaaccat atgctttatg agtaacttag gtagaagtta tggtggaaat       120
     ccaaaaagta tttacgaaga aatggtaagg gaaggactcg ataaggagtt tcgttgcatt       180
     tttttccttg aggatacgaa tgcgccaatt cctggtaggg tatggaaagt aaagctttct       240
     cgttttcgct attattattt cttggctgta gccggtatct gggtgagtga tacaagattt       300
     ccgaactaca taaaaaaacg aaagggtgtt acctacctac aaacatggca tggtacacct       360
     ttaaaaaagt tagccttgga catgacgtca ttagtgatgg ctggtgagga aaccttagaa       420
     caatataaag aagaatttaa gaaaaactct gcaacatggg actatcttat ttctcagaat       480
     ccattttcta cggaaacctt tagaagagca tttgactttc aaggagaaat attagaatat       540
     ggatatccaa gaaatgatgt cttatttcaa aaaaataatt cttatgatat tgatcagata       600
     aagaagaaac taaatatacc tagagataaa aagataattc tttatgcacc aacatggcga       660
     gataatgaat accacgataa agcaaactat aaatttaatg ctccacttga ttacaattat       720
     ttatatgagc aattaaaaga tgagtatgtg atattgttaa agtatcatta tatggtaaga       780
     gagaagcttc cgttggagca ataccgagga ttttacatgg tagtggaaca agagattgat       840
     atttcagaat tatatcttgt atcggatatg ttaattacag attattcttc tgttatgttt       900
     gattatagtc ttttatatcg cccaatactt ttttatgtat atgatttaaa ggaatatgag       960
     gataatcttc gaggctttta ttttgatttt gtagaggagg ctcctggacc attatttact      1020
     tcatcaagag aacttgtttc tatggtaaag aattattatc cagaagacta tgctgacaaa      1080
     tataaagcgt tctgtgataa atatcataca tttgagaatg gaaatgcagc gaaacgtacg      1140
     gttagacttc tatcagaaaa gggaatgaag taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page