(data stored in SCRATCH zone)

EMBL: CP000885.PE301

CP000885.PE301       Location/Qualifiers
FT   CDS_pept        381918..383780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0305"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: cth:Cthe_2244
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40692"
FT                   /db_xref="GOA:A9KSP8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSP8"
FT                   /protein_id="ABX40692.1"
FT                   /translation="MSLMSSLYVGVSGLQVSQNGLNTTGHNLANVETEGYVRQQTVLQT
FT                   SQYRTIGQSYISPMQLGLGAETAAVRQVRDIFLDKSYRQELGRRGFYDSQYETVSEIEN
FT                   LMGELEGVAFQDSIADFWKNLQELAKEPDSLVKRASLVETSVGFVERSENLFKQLRDYQ
FT                   LNLNLKITNTISRINEIGDQISSLNDRICAYESNRVEHANDLRDTRNKLLDELSQMITI
FT                   TYRENADGRVTVNAEGVPFVTEDLTHHMGSMTVTQIRQRQLDEDEFNSTGMMENSDMLI
FT                   PIWPTYGNVEVFNRDLIPNPVDNSDIGSLKGLILARGTKVAKATDIPIAPNKDNYLDEF
FT                   GDLKEDEYNLALKDYKEAVKTYNKTIEPSIVMSTQAQYDQLIHGIVTKINDILCPNKEV
FT                   VIAAGTTIQLSNGDTYTYDKDTVIKIFDDENAPIGINGEGGTELFSRKSMPRYMDYQEI
FT                   TLANGDTILAKIYNEEDEANNYSLYTVGELVVNQEMIEDKSKIPLSQSSNTGDYDIKTT
FT                   ERLLKAWQEPFATLSPNTLTKSNINDYYNALIGGIATTGERYHTIVKSQEGMVTSIDNQ
FT                   RQSVLGVASDDELTSLIKFQHAYNAAARYINVIDQMLEHIVTRI"
     atgagcttaa tgagtagctt atatgtaggt gtatctggat tacaagtcag tcaaaatggt        60
     ctgaatacca caggacataa tcttgcaaac gtagaaacgg aaggttatgt tagacagcaa       120
     acggtattac agacatctca atatcgaaca ataggacaat cgtatatttc cccaatgcaa       180
     ttaggccttg gagcagaaac agctgctgtt cgtcaggtta gagatatctt tttagataaa       240
     tcttatcgac aagagcttgg gcgtcgaggg ttctatgatt ctcagtatga aacagtatcc       300
     gagattgaaa acttaatggg tgagcttgag ggcgttgcgt tccaggattc tattgctgac       360
     ttttggaaaa acttacaaga actcgcgaaa gaaccggata gtttagtaaa gagagcttca       420
     cttgtagaaa caagtgtcgg ctttgttgaa cgctctgaga atttattcaa acagcttcgg       480
     gactatcaat taaatttaaa tttaaaaata acgaatacga tctctcgtat taatgaaatt       540
     ggagatcaaa tctcgagttt aaatgataga atttgtgctt atgaaagcaa tcgagtagag       600
     cacgcgaacg acttaagaga cacgagaaat aaattattag atgagttgtc tcaaatgatt       660
     accattacat atcgtgaaaa tgcagatggt agagttactg taaatgcgga aggagttcca       720
     tttgtaacag aagatcttac acatcatatg gggagcatga cagtaacaca aatcagacaa       780
     cgacagcttg acgaggatga atttaattca accggtatga tggaaaattc ggatatgtta       840
     attccgattt ggccaacgta tggtaatgta gaagtattca atcgtgattt gataccaaat       900
     ccagtagata attctgatat tggttcttta aaaggcttga ttttagcgag aggaacaaaa       960
     gtagcaaaag ctacggatat tccgatcgca cctaataaag ataattactt ggacgagttt      1020
     ggcgacttaa aggaagatga atataatctt gcattaaaag attataaaga ggctgttaag      1080
     acatacaaca aaacaataga accatccatt gttatgtcaa ctcaggcaca gtacgatcag      1140
     ttaatccatg gtattgtaac aaagattaat gacatcttat gccctaacaa agaagtagtt      1200
     atcgcagcag gaactacgat tcaactttca aatggtgata cgtatactta cgataaggat      1260
     acggtaatta agatttttga tgatgagaat gctccaattg gaatcaatgg tgaaggtggt      1320
     acggagttat ttagtcgtaa atccatgcct cgttatatgg attaccaaga gattactttg      1380
     gctaatgggg ataccattct tgctaagatt tacaatgagg aagacgaggc aaacaattat      1440
     tccttgtata cggttggtga actggtagta aatcaggaga tgattgagga taagtcaaag      1500
     attccattaa gccagagttc taacactgga gattatgata tcaagactac ggagagatta      1560
     ttaaaagcat ggcaggaacc atttgcaacc ctttctccaa atacattaac aaaatcaaac      1620
     attaatgatt attacaatgc attaatcgga ggtatagcaa ctaccggtga gcgttatcat      1680
     acgattgtta agagtcagga aggtatggta acaagcattg acaatcagcg tcaatcagtt      1740
     cttggagtag cctctgacga tgaacttaca agtttaatta aattccaaca tgcgtataac      1800
     gcagctgcta gatatataaa cgtaatagat caaatgcttg agcatattgt aacgagaata      1860
     tag                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page