(data stored in SCRATCH zone)

EMBL: CP000885.PE303

CP000885.PE303       Location/Qualifiers
FT   CDS_pept        385771..387315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0307"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: csc:Csac_1665 flagellar
FT                   hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40694"
FT                   /db_xref="GOA:A9KSQ0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ0"
FT                   /protein_id="ABX40694.1"
FT                   /translation="MEVSMRITNKMMTNNVLYNINNNKNSLSKTEQQYSTGKKIQRPSE
FT                   DPIVAVRALKLRTNLTELNQYYEKNIPDALAWMDLTESSLSNINEILTKIHTYCVNGAN
FT                   DTLTEEDRNSLAVNLNQLKDQIYQEGNTNYAGRYVFSGYKTDSSLVFSENTSKYNYLLT
FT                   ERLSGANLDVIQKSINSFDLSSYNPNAPWDTSFDEKPNYITAHRLRLAYNNLKNLDDGQ
FT                   LKIEIADQDSDGNVILDGDGNRTYTEYSGIIESRLSTDEDAYTPPDGTIYFLADTGELI
FT                   LPEDVYQDFRDKVDIKVSYEKNSFVKNDLKPEHYFDCVQTDLTSDDLVERNFTKQNQEI
FT                   RYEINFSQSMVVNTQGSDAITHNIGRTIDDIIFAVNSVIAVDKKISEVNKMLASGNITE
FT                   EQKTTLNQALEVLTAEKILKDEVMQKTFGSALSGIKEQQNIINVAVSDLGSRSVRIQLT
FT                   ESRLSMEQVDFEDLLSKNEDADIVDTIIKMKSQESVYNASLSAAAKIVKNSLLDFL"
     atggaggtta gtatgagaat tacaaataaa atgatgacaa acaatgttct ttataatatt        60
     aacaataata agaacagttt gtccaaaaca gaacaacaat actccaccgg taagaagata       120
     cagcgtcctt cagaagaccc tatcgttgca gtacgtgcgt tgaaacttcg taccaatctt       180
     acagaactaa atcaatatta tgaaaagaat attccagatg ccctagcgtg gatggatttg       240
     acagaaagtt ctttaagtaa cattaatgag attctaacga agatacacac atattgcgtg       300
     aatggtgcta atgatacctt aacggaagag gatagaaaca gtcttgcagt taatttaaat       360
     caattaaagg accagattta tcaagaaggc aatacaaact atgcagggag atatgttttt       420
     agtggatata agacggattc tagtttagtt ttttctgaaa atacatcaaa atataattat       480
     ttattaacag aaagattaag cggagctaac ttagatgtca ttcaaaaatc gattaattcc       540
     tttgatctat cttcttataa tccaaatgca ccatgggata ctagttttga tgaaaaaccg       600
     aattatatca cggcacaccg tttaagatta gcatataaca atctcaaaaa cttggacgat       660
     ggacaattaa agattgagat tgccgaccaa gattccgatg gtaatgtaat tcttgacggt       720
     gatggaaata gaacgtatac tgaatatagt ggtattatcg aatcgaggtt atcaacagat       780
     gaagacgcgt atactccgcc agatggaact atttattttc tagctgatac tggtgaattg       840
     attttaccag aggatgtata tcaagatttc cgtgataagg ttgatattaa ggtttcttac       900
     gagaagaatt cttttgtgaa gaatgattta aaacctgaac attattttga ttgcgtacaa       960
     actgatttaa caagcgatga tcttgtagag cgtaacttta caaaacagaa ccaggaaatc      1020
     cgttatgaga taaactttag tcaatcaatg gtggtgaata cgcaaggtag tgatgcaatc      1080
     actcacaata taggaagaac cattgatgat attatttttg cggtaaacag tgttattgca      1140
     gttgataaaa agatctctga agttaataag atgttagcaa gcggaaatat tactgaagag      1200
     caaaaaacaa cattaaatca ggctttagaa gtattaacgg ctgagaagat tctaaaagat      1260
     gaggtaatgc aaaaaacatt tggaagtgcc ctctcaggaa taaaagaaca gcaaaatatt      1320
     atcaatgttg cagtttctga tttaggtagc cgatctgtta gaatacagct tacagaaagt      1380
     cgtttatcga tggaacaagt tgattttgag gatctactct caaagaatga ggatgcagat      1440
     atagtagata cgataatcaa aatgaaatca caggaatctg tatataatgc ttctttatct      1500
     gctgctgcta agattgtaaa gaattcgtta ttagacttcc tataa                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page