(data stored in SCRATCH zone)

EMBL: CP000885.PE306

CP000885.PE306       Location/Qualifiers
FT   CDS_pept        388399..388887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40697"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSQ3"
FT                   /protein_id="ABX40697.1"
FT                   /translation="MEKNETIKTYLCALIISLEKKEQVLIKLISITKKQKIALEAQPPN
FT                   LEEFKLEVSNKEVLIKEINELDIQFESLFHKVKAYVPDVATDYALEIKKMQEMVPRVVE
FT                   LGVTLRGLEQQNKMKLELISTTRAKEVVNVKKSSKSVAECYRAIHNLKDNKTWLDQKK"
     gtggaaaaaa atgaaacaat taaaacttat ttatgtgcgt tgattataag tttagaaaag        60
     aaagaacaag tactaattaa actaatatca ataacaaaaa aacaaaagat agcattagaa       120
     gctcaacctc ctaatttaga ggaatttaaa ttagaagtat caaataaaga agtattaata       180
     aaagaaatta atgaattgga tattcaattt gaatcattgt ttcataaagt taaagcctat       240
     gttccggatg ttgcaactga ttacgcttta gaaattaaaa aaatgcagga gatggttcca       300
     agagttgttg aacttggggt tactctacga ggtttagaac agcagaataa aatgaaatta       360
     gagcttatat ctacaaccag ggcgaaagaa gtagtaaatg tgaaaaagag tagtaaatct       420
     gttgcagagt gctatagagc gattcataat ttaaaagaca ataagacgtg gttagatcaa       480
     aagaagtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page