(data stored in SCRATCH zone)

EMBL: CP000885.PE313

CP000885.PE313       Location/Qualifiers
FT   CDS_pept        395189..396976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40704"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR0"
FT                   /protein_id="ABX40704.1"
FT                   /translation="MKIDTKTHRKWNNYSNFVKFLGCFLLLFAFSVSLIAFGKLTAYGQ
FT                   TGRSVTYSDITIDHTKGEIRISVQSGDTILYCDAKKLDWMEATTTVNGTNSVAVIDISW
FT                   INRSKEYILGIKNKDETSDDAMVQINLRPREEGLKVGLSGTSTLIDKVVNKPLELVYPT
FT                   NYTINSVCKEYGYIYFYTGNGSTARYYEEYDNIEWKNGADGVWREFKELNPAIYANKGA
FT                   SLYFRVKTAVEEKLTTTVDKQGVYVTKGAPAGKEVRFSYPKLANAPKVALNGGDLTVAL
FT                   RAGYEYRLPGGEWVNVVDAHANSLGKIDPVSLYSLYEKYNRNDNSQNKKFTFQYQEFVM
FT                   QIRVAATSKKPSSKSFNLNVEAPKATETTGIDISYTLPYSKKDGISFTNSNPDSYQVAL
FT                   ISSKFCGGVGTFDASKVDYKQVKWYTVKPGTTEKPSVVKIAGTAYTGKNEIEQPILIYR
FT                   LAPINESKTQKQMIASKAIAVNLPTEVVQTVTDSVQSKVELVQGAAAEGKIEVSTTNVS
FT                   VGATPKISALKKPTGITITADKVKTDGKFTISVKITSAAKVVDSYKFNVTIEGVTKEYS
FT                   VTIKEKPAPTPTVTPTPTP"
     atgaaaattg atactaaaac acacaggaaa tggaataatt attccaactt tgtaaagttt        60
     ctaggttgtt ttctattatt gttcgcattt agtgtgagct tgattgcctt tggtaagttg       120
     actgcttatg gtcaaacagg acgaagtgtt acatatagtg acatcaccat tgatcataca       180
     aaaggtgaga taagaatttc tgtacaatct ggtgatacaa ttctttactg tgatgctaaa       240
     aaactagatt ggatggaagc aaccacaacg gttaatggta ctaattcggt tgcagttatt       300
     gatatatcct ggattaaccg ttccaaagag tatattcttg gtatcaagaa taaagatgag       360
     acttccgatg acgctatggt gcaaatcaac ttacgtccaa gagaagaagg acttaaagta       420
     gggttaagcg ggacatctac ccttattgat aaagttgtta acaagccatt ggaattggta       480
     tatccgacca attatacgat taattcagta tgtaaagaat atggttatat atacttttat       540
     acaggcaatg gtagcacggc aagatattac gaagagtatg ataacattga gtggaaaaat       600
     ggcgctgatg gagtatggag agagtttaaa gaattaaatc ctgcaatcta tgccaacaaa       660
     ggagcctccc tttatttcag agttaagact gcagtggaag aaaaattgac tactactgtt       720
     gacaagcaag gagtttatgt aacaaaaggc gctcctgctg gtaaagaagt tcgttttagt       780
     tatccaaagc ttgctaatgc tccaaaggta gctttgaatg gcggtgattt aacagttgca       840
     ttacgtgctg gatatgaata tcgccttcca ggtggtgagt gggttaatgt tgtggatgca       900
     catgcaaact cattaggaaa aatagaccca gtatctcttt actcgctata tgagaaatat       960
     aatagaaatg ataattcaca aaataaaaaa tttacattcc agtatcaaga gtttgtgatg      1020
     caaattagag ttgcagcaac atcaaagaag ccatcttcaa aatcatttaa tttaaatgta      1080
     gaggctccaa aagctacaga gacgacagga atcgatattt cttatacact accatatagt      1140
     aaaaaagatg gaatttcgtt tactaattct aatccagaca gttatcaagt agcacttatt      1200
     agtagtaagt tctgtggtgg agtcggtact ttcgatgcat ctaaggtgga ttataaacaa      1260
     gttaagtggt atactgtaaa acctggaacg acagaaaaac catctgtagt aaagatcgct      1320
     ggtactgcgt atacagggaa aaatgaaata gaacaaccaa ttcttattta ccgtttagca      1380
     ccaattaatg aatcgaaaac acaaaagcaa atgattgctt ctaaggctat agcagtaaat      1440
     ttaccaacag aggtagttca aacagtaaca gattccgttc aatctaaggt tgagcttgtg      1500
     caaggagctg cagcagaagg taaaattgaa gtttcgacta cgaatgtttc cgtaggagcg      1560
     actccaaaga tttcagctct taaaaaacca acaggtatta caattactgc tgataaagta      1620
     aaaacagatg gaaagtttac tatctcagta aaaattacga gtgcggctaa ggtagttgat      1680
     tcctataaat ttaatgtaac aattgaaggc gtaactaagg aatactcagt tactataaag      1740
     gaaaaaccag caccaacccc aacggtaaca ccgacaccta ctccgtag                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page