(data stored in SCRATCH zone)

EMBL: CP000885.PE322

CP000885.PE322       Location/Qualifiers
FT   CDS_pept        406898..408943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0326"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: cbe:Cbei_3037 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40713"
FT                   /db_xref="GOA:A9KSR9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSR9"
FT                   /protein_id="ABX40713.1"
FT                   /translation="MDNRDKNGGDKKKNWPGKRGWIFSLVAALIMVMLFSYMTKQLERS
FT                   RIEEISFNEFLAMIENNNQNKIDHIEIDYSKNQYTIYTELAKNNPREKIYVAGIPRDYP
FT                   VSELLIEKGIKELPNRNDNETTIVDILLAYVLPFVLIYGVMFFLFRMISKSGGGMMGVG
FT                   KSNAKVYVEKETGVTFKDVAGQEEAKESLTELVDFLHNPGKYTRIGAKLPKGALLVGPP
FT                   GTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRDLFKQAQTQAPCIVFIDEI
FT                   DAIGKSRDSHYGGGNDEREQTLNQLLSEMDGFDTSKGIVILAATNRPEVLDKALLRPGR
FT                   FDRRVIVDKPDLKGRIETLKVHAKNVLMHDSVDLEEIGLATSGAVGSDLANMINEAAIL
FT                   AVKEGRTVVTQNDLFESVEVVIAGKEKKDRILGPEEKKIVAYHEVGHALVTALEKNAEP
FT                   VQKITIVPRTMGSLGYVMQVPEEEKYLMSKDELLARIVTLYGGRAAEELVFGSITTGAS
FT                   NDIEKATSLARAMVTQYGMSDRFGLIGLESVENRYLDGRAVLNCGDATAAEIDSEVMAI
FT                   LKKCYDRAKELLAGNRDVLDKIADFLVNKETITGKEFMKIYHEVKGIPEEEKELISSEE
FT                   RNKIREVSVRKQDNHESSSSIVRAAELKEKTETEEEMNSNSGNTVL"
     atggacaata gagataaaaa cggtggagac aagaaaaaga actggccggg aaaacgcggt        60
     tggattttta gtcttgttgc agccttaatc atggtaatgc tcttttctta tatgacaaag       120
     caattagagc ggagcagaat cgaagaaata tcatttaatg aatttcttgc gatgattgaa       180
     aataacaacc aaaataagat agatcatata gaaattgatt atagtaaaaa ccagtatacg       240
     atttatactg aactagctaa aaataatccc cgagagaaga tttatgttgc gggtattcca       300
     cgtgattatc ctgttagcga gttattgata gaaaagggaa ttaaagaatt accaaatcgt       360
     aatgataatg aaacaactat cgttgatata ttgttggcgt atgtgttacc ttttgtttta       420
     atttatggtg ttatgttctt tttattccgt atgatttcta agagtggcgg cggaatgatg       480
     ggggttggaa aaagtaatgc gaaggtctat gtcgaaaaag agactggtgt gacatttaaa       540
     gatgtagctg gtcaggaaga ggcgaaagag tctctgacag aattagtgga ttttcttcat       600
     aaccctggaa aatatacaag aatcggtgcg aaacttccaa aaggtgctct tcttgtggga       660
     cctccgggta ctggtaaaac tctattagca aaagctgtag cgggagaagc gaaagttccg       720
     tttttctctc tatcaggttc tgattttgtt gaaatgtttg ttggtgtagg agcatctcgt       780
     gtacgtgact tgtttaagca agcacaaact caagcaccat gtatcgtgtt tattgacgag       840
     attgatgcca taggtaagag cagagattcc cattatggcg gtggaaatga tgagcgagag       900
     caaacattaa atcagttgct ttctgagatg gatggttttg atacttccaa aggtattgtt       960
     atcttagctg ctacgaaccg accagaagta ctagataagg cacttcttcg tccaggacga      1020
     tttgatcgaa gagttattgt agataaaccg gatttgaaag gccgtattga gactttaaag      1080
     gttcatgcaa agaatgtatt aatgcatgac tctgtggatt tagaagaaat tggacttgca      1140
     accagtggag cagttggatc tgatttagcc aatatgatta atgaagctgc aatattagca      1200
     gtgaaagaag gtagaacagt agttactcaa aacgatttgt ttgaatcggt tgaagtcgtt      1260
     attgctggta aggagaagaa ggatcgtatt cttggaccag aagaaaagaa gatagttgca      1320
     taccacgaag tgggacatgc tttagtaaca gctttagaga aaaatgctga gccagttcaa      1380
     aagattacca tagtaccacg tacaatggga tctcttggtt acgtaatgca agtaccagaa      1440
     gaagaaaaat atctgatgag taaggatgag ttgttagcac gaattgttac cttatatggt      1500
     ggacgtgccg cggaagaatt agtatttggt tccattacta ctggagcttc caatgatatt      1560
     gagaaggcaa cctctcttgc ccgtgcaatg gtaacacagt atggtatgtc agatcgattt      1620
     ggtttgatcg gattagaatc tgtggaaaat cgttatctgg atggtagagc ggtacttaat      1680
     tgtggagatg ccactgcagc tgaaattgat agcgaagtca tggcaattct taagaagtgc      1740
     tatgaccgtg caaaagagct tttggcaggt aatcgtgatg tattagataa gattgcagac      1800
     ttcctagtaa acaaagaaac gattacagga aaagaattca tgaagattta tcatgaagta      1860
     aaagggatcc ctgaagaaga gaaggagttg atctcttccg aagaaagaaa taaaattaga      1920
     gaagtatctg taagaaaaca ggataatcat gagtcaagtt catcaatagt aagagcagca      1980
     gaactgaagg aaaaaacgga aactgaggaa gaaatgaata gtaactcagg gaataccgtg      2040
     ttatag                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page