(data stored in SCRATCH zone)

EMBL: CP000885.PE324

CP000885.PE324       Location/Qualifiers
FT   CDS_pept        411257..412186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0328"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: cth:Cthe_0110 HPr
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40715"
FT                   /db_xref="GOA:A9KSS1"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9KSS1"
FT                   /protein_id="ABX40715.1"
FT                   /translation="MYTVELGKLVEKMNLENCTPEIDISSIQITQPDVNRPALQLTGFF
FT                   DYFDSDRVQIIGNVEHAYMQKMEKDHGLGIMKKLMSFKMPCIVFCRGIEVSEDFKEVAI
FT                   EEGVPIFRTEKTTSSFMAEVIRWLKVELAPRISIHGVLVDVYGEGILIMGESGIGKSEA
FT                   ALELIKRGHRLVTDDLVEIKKVSDDTLIGTAPDITRHFIELRGIGIIDVKTLFGVESVK
FT                   NTQSIDLVIKLEEWNRDKEYDRLGLEEQYIEFLGNRVVCHNIPIRPGRNLAVICESAAV
FT                   NYRQKKMGYNAAQELYNRVTNNLLKKSK"
     atgtatactg ttgaattggg aaaattagtg gaaaagatga acctggaaaa ctgcactcct        60
     gaaattgata tcagcagcat tcaaataaca cagcctgatg tgaatcgtcc tgcgttacag       120
     ctgactggtt tttttgatta ttttgattct gatcgtgtac aaattattgg aaatgttgag       180
     cacgcttata tgcaaaagat ggagaaggat cacggacttg gtatcatgaa aaagcttatg       240
     agctttaaga tgccatgtat cgttttctgt cgtggtattg aagtttctga agactttaaa       300
     gaagttgcaa tagaggaagg agtacctatt ttccgcactg aaaagacaac ctcctctttt       360
     atggcagaag taattcgctg gttaaaagta gaattagcac caagaatatc aatccatgga       420
     gtattagttg atgtctatgg tgaaggtatt ttgattatgg gcgagagtgg aattggaaaa       480
     agtgaagcag ctcttgaact aattaaacgt ggacaccgtc ttgttacaga tgacttagta       540
     gagattaaaa aagttagtga tgatacctta attggtacag caccagatat cacacgtcac       600
     tttattgaat tacgtggtat tggtattatt gacgtaaaga cgttattcgg tgttgagagt       660
     gttaagaata cacaatcaat tgacttagta atcaaattag aggaatggaa tagagataaa       720
     gagtatgacc gtcttggtct tgaggaacag tacattgaat tccttggtaa tagggtagta       780
     tgtcataata taccgattcg tccaggacgt aatcttgctg ttatttgcga gtctgcagct       840
     gttaattacc gtcaaaagaa gatgggttat aatgcagctc aagaattata taatcgtgta       900
     acaaataatt tattaaaaaa gagtaagtaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page