(data stored in SCRATCH zone)

EMBL: CP000885.PE331

CP000885.PE331       Location/Qualifiers
FT   CDS_pept        418448..422008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0335"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tte:TTE1818 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40722"
FT                   /db_xref="GOA:A9KSS8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A9KSS8"
FT                   /protein_id="ABX40722.1"
FT                   /translation="MSFTHLHVHTEFSLLDGSGKIKEMAAQAKKLGMDALAITDHGVMY
FT                   GVIDFYRACLAEGIKPIIGCEVYVAPNSRFDKEGSASEERYHHLVLLAENDIGYHNLIK
FT                   IVSRGFTEGFYYKPRVDHELLKEYSEGIIALSACLAGEVAVMLRRNFFEEAKASALKLQ
FT                   EIFGAGNFFLELQDHGYPEQKSVNQGLLRISEETNIPLVATNDIHYTYDTDETAHDILL
FT                   CIQTQKKVTDEDRMRYAGGQFYMKSPEEMRELFPYALQALQNTEEIAKRCNVTIEFGHY
FT                   KLPKYDVPAPYTVSPGSGSTDDEGDISASQNISTNTDILAREYLRKLCEEGLVRRYKDP
FT                   STELWDRLNYELETIENMGFVDYFLIVWDFIKYAKDNDIIVGPGRGSAAGSVVSYCLEI
FT                   TNIDPIKYSLLFERFLNPERLTMPDIDIDFCFERRQEVIDYVVSKYGKDRVVQIVTFGT
FT                   MAARAVIRDVGRALDMPYASVDVVAKMIPTELGITIEKALNINPDLKKLYESDPEVMHL
FT                   IDMSKRLEGLPRHTSMHAAGVVISNAPADEYVPLSRSSDDSITTQFTMTTLEELGLLKM
FT                   DFLGLRTLTVIQNAVLLVNQAKARLGETEENFLNIDEIDYNDSKVLDLISSAKTEGIFQ
FT                   LESSGMKSFMKELKPQNLEDIIAGISLYRPGPMDFIPKYIQGKNNQKSIQYECKELEPI
FT                   LSPTYGCIVYQEQVMQIVRELAGYSFGRSDLVRRAMSKKKASVMEKERQSFVYGNVEEG
FT                   VPGCISKGIPEAVANHIYDEMTDFAKYAFNKSHAAAYAVVSYQTAYLKCYYPVEFMAAL
FT                   MTSVIDNPSKVAEYIYTCRQMGIKLLPPDINDGYATFTVSGENIRYGLSAIKGLGRPVI
FT                   DALVIEREENGPYLNLKDFASRLSGKEVNKRTIESFIKSGAFDSMPGTRKQLMHVYVGV
FT                   LDGVSQEKKRAMTGQMSLFDLDGDAKVMNEEIIFPEVGEYSKEELLAFEKEVLGIYVSG
FT                   HPLEAYELLLKRNATANTADFIVEEETNTVKVADGDTVTVGGMITSRTLKTTRTNAVMA
FT                   FITLEDMFGTMEVIIFPRDYEKFKYTLEIDNRVFIKGKVAVEEDKPAKLICQSITPFAD
FT                   ISKELWVKFSDKEAFLNNEKALYEIIKNYDGNDRITVYCEKEKAIKKLPLSQSVIIEEG
FT                   LLENLRNAFSEENIKVVEKL"
     atgagtttta cacatttgca tgtgcataca gagttcagtc tactagatgg ctctggtaaa        60
     ataaaggaaa tggctgccca agcgaaaaaa cttgggatgg atgcactagc aattacggat       120
     catggagtta tgtatggtgt tattgatttc taccgtgcat gtttggcaga aggaataaag       180
     ccaattatcg gttgtgaagt ttatgttgca ccaaactcca gatttgataa agaaggtagt       240
     gcgagtgagg aacgatatca tcatcttgtt ttattagcgg agaatgatat cggttatcac       300
     aacttaatta aaattgtatc aaggggcttc acagaaggct tttattataa accaagagta       360
     gatcatgaat tattaaagga atacagcgaa ggtatcatag cgctgtcggc atgtcttgct       420
     ggtgaagttg cagtgatgct tcgaagaaat ttctttgaag aagcgaaagc atcggcctta       480
     aagttgcaag agattttcgg tgctgggaat ttctttttgg aattgcaaga ccatggttat       540
     ccggagcaaa agtcagtgaa tcaaggttta ctaagaataa gtgaagaaac caatattcca       600
     ctggttgcta ccaatgatat tcactacacc tatgacactg atgaaactgc ccatgatatt       660
     ttactttgta tccaaacaca gaagaaagta acggatgaag atcgtatgcg ttatgcgggt       720
     ggtcaatttt acatgaaatc tccagaggag atgagagagt tatttccata tgctctgcag       780
     gcgcttcaaa atacagagga gatagcaaag cgttgtaatg taacaattga atttggtcat       840
     tataaacttc cgaaatatga tgtcccagcg ccttatacag taagccctgg aagtggaagc       900
     actgatgatg agggcgacat cagtgcaagc caaaatatca gtacaaacac tgatattttg       960
     gccagagagt atttaagaaa gctctgtgaa gagggattgg tacgtcgcta taaggaccca      1020
     tcaacggaac tttgggatag attaaactat gagcttgaaa caatagagaa catgggattt      1080
     gtcgattatt tcttaattgt ttgggacttt attaaatatg caaaagacaa tgatattatt      1140
     gtaggtcctg gtcgtggtag tgctgcggga agtgttgtct cttactgttt ggagattaca      1200
     aatattgacc caatcaaata tagcctcttg tttgagcgat ttctaaatcc agagcgtctt      1260
     acgatgccag atattgatat cgatttttgt ttcgagcgtc gtcaggaagt gatagattat      1320
     gtggtatcga agtatggaaa ggatcgagta gttcagattg ttacctttgg aacaatggca      1380
     gcaagagcgg taatccgtga cgtgggtcgt gcacttgata tgccgtacgc ttcagttgat      1440
     gtggttgcaa agatgattcc aacagaactt gggattacca ttgaaaaagc acttaatatt      1500
     aatccggatt taaagaagct ctatgaatct gatccagaag taatgcattt aatagatatg      1560
     tcaaagcgtt tagagggttt accacgccat acctccatgc acgctgcagg cgttgttatc      1620
     agtaatgctc cggcagatga atatgttcca ttatctaggt catcagatga ttccattaca      1680
     actcagttta cgatgactac cttagaggaa cttggattac tcaaaatgga ctttttagga      1740
     cttcgtacct taacagtaat tcaaaatgca gttttgcttg tgaaccaagc gaaagctaga      1800
     ctcggagaga ccgaagagaa ttttcttaac attgatgaaa ttgattataa tgactcaaaa      1860
     gtattggatt taatttcttc tgcaaagaca gagggtattt ttcagctaga aagctcagga      1920
     atgaagagtt tcatgaagga attaaaacct cagaacctag aagatattat cgccggtatc      1980
     tctttatacc gtcctggtcc aatggacttt ataccaaaat acattcaagg aaaaaataat      2040
     caaaaaagta ttcagtatga atgtaaggaa ctagaaccaa tcttatcacc aacttatggt      2100
     tgtatcgtat atcaggagca ggttatgcag atcgttcgag agcttgcagg atatagcttt      2160
     ggacgaagtg acttggtgcg ccgtgcaatg tcgaaaaaga aagcatccgt aatggagaaa      2220
     gagagacaaa gcttcgtata tggaaatgtt gaagaagggg tacctggttg tatatccaaa      2280
     ggtattccag aagccgttgc caatcacatc tacgatgaga tgacagactt tgcaaaatat      2340
     gcttttaata aatctcatgc ggctgcatat gcggtagtat cttatcaaac agcatatcta      2400
     aaatgttact atccggtaga gttcatggca gcactaatga cttccgtgat tgataatcca      2460
     agtaaggtgg cagaatatat ctatacttgc cgccagatgg gaataaaact tctaccaccg      2520
     gatattaatg atggatatgc tacctttacg gtaagtggtg aaaatattcg atatggactc      2580
     tctgcaatta aagggcttgg aagaccagtg attgatgcct tggtaattga gagagaagaa      2640
     aatggtccat atcttaactt aaaggatttc gcgtcaagac tttctggaaa agaagtgaat      2700
     aaacgaacca ttgaaagttt catcaaatca ggcgcttttg acagcatgcc aggaacaaga      2760
     aagcaattaa tgcatgtcta tgtcggggta ctagatggag taagccaaga aaagaaaaga      2820
     gcgatgacgg ggcagatgag cctgtttgat cttgatggtg atgcgaaggt tatgaatgag      2880
     gagattattt tcccagaggt aggggaatat tcgaaagaag agttacttgc atttgagaag      2940
     gaagtacttg gaatctatgt tagcggtcac ccattagagg cctatgaact actgttaaaa      3000
     agaaatgcaa ctgcgaatac agcggatttt atcgtcgaag aggagacgaa tacagtaaaa      3060
     gtagcagatg gtgatacggt tactgttggt ggtatgataa cctctcgaac gttaaaaaca      3120
     acgagaacga acgctgttat ggcattcatt acattggaag atatgtttgg tacgatggaa      3180
     gtcatcatct tcccacgtga ttacgagaag tttaaataca cattggaaat tgataatcga      3240
     gtatttatca aaggaaaagt ggcagtagaa gaggataaac cggcaaaatt aatctgtcaa      3300
     tcgataactc cttttgcgga tattagtaaa gagttatggg taaaattctc ggataaagaa      3360
     gcatttttaa ataacgaaaa ggcattgtat gaaatcataa agaattatga tggcaatgat      3420
     cgtattacag tatattgtga gaaggaaaaa gcgattaaaa aattaccact aagtcaaagt      3480
     gttattatcg aagagggact tcttgaaaac ctaagaaatg cattttctga ggagaatata      3540
     aaagttgttg aaaagttata a                                                3561
//

If you have problems or comments...

PBIL Back to PBIL home page