(data stored in SCRATCH zone)

EMBL: CP000885.PE337

CP000885.PE337       Location/Qualifiers
FT   CDS_pept        430405..432018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0341"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bld:BLi01384 lipoprotein; RBL02387"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40728"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A9KST4"
FT                   /protein_id="ABX40728.1"
FT                   /translation="MRKKKLLSMLLAAALVVTSLAGCSAKEEKTGGQGNVATQPPKGNE
FT                   NAGVSNTPKERPKVSIMSFDYSGQAMMGPNAEQVIKVLEDYTETNLEFQFVPSDAYEDK
FT                   LSLTLASGSDMPMIIACGSFNANIVNNARAGAFWDLNDFIYDEAKYPNLSKANKNISNM
FT                   VSVDGSLYGIYRARTLGRNGFGYRKDWADKLGLKEPETIDDVYNMLYQFTYGDPDGNGK
FT                   KDTYGLNLCKYTGPLDIMQTWFGCGNGWVDQNGSLVPVHQTPEYEEALDWFKKLYDDGL
FT                   IAKDWAVRETGTWTDDNKNGISGMYIDTIDNARKVWDYYVNNNIPSVLNDGTIATFAMG
FT                   GGIAKTAGGQKHTLATAGYNGFFVLTKGGCKTEADVEAALHFLDKMNDDEMQILSSYGL
FT                   KDIHYSLDENNVFTDIKGDNKDTLLLDYEALNQTVAYIPTNTITGIKIPTTERQDIQAE
FT                   LYIQNEKNVVFNPAAALIINSETYTLNGANLDQIINDARTQYIVGEINKDGLKAAWNLW
FT                   ASTGGSDVIKEVNDAYAKTK"
     gtgagaaaga aaaagttatt atccatgtta cttgctgctg ctctcgttgt tacgagtctt        60
     gcaggatgta gcgctaagga agaaaagaca ggcggccaag gtaatgttgc tacgcagcct       120
     ccaaagggga atgagaatgc tggagtaagt aatacaccaa aagaaagacc gaaagttagt       180
     attatgtcat ttgactattc cggtcaagct atgatggggc caaatgcaga acaagtaatt       240
     aaagtgttag aagattatac ggaaactaat cttgagtttc aatttgtacc tagtgatgca       300
     tatgaggata aattaagttt aaccttggct tctggttctg atatgccaat gattatcgca       360
     tgtggttctt tcaatgcaaa catagtaaat aatgcaagag caggtgcctt ctgggattta       420
     aacgacttta tttatgatga ggcgaaatat ccaaatcttt caaaagctaa taaaaatatc       480
     agcaatatgg tgtctgttga cggtagttta tacgggatat accgcgcaag aacgcttgga       540
     cgtaacggtt ttggataccg taaggactgg gcagataaat taggtttaaa agagcctgag       600
     acaattgatg atgtatataa tatgctatat cagtttacct atggtgatcc ggatggtaat       660
     ggaaaaaagg atacatatgg gttaaacctt tgtaaatata caggaccact tgatattatg       720
     cagacttggt ttggctgtgg taatggttgg gtagatcaaa atggttcctt ggttccggta       780
     catcagacac cggagtatga agaggcactg gactggttta agaagttata tgatgatggc       840
     ttaattgcaa aggattgggc agtacgtgag acaggaactt ggacggatga taataagaat       900
     ggtatatcag gtatgtatat cgacacgatt gataatgcaa gaaaagtatg ggattactat       960
     gtaaacaata acattcctag tgtattaaat gacggtacta ttgcaacctt tgcaatgggg      1020
     ggaggtattg ctaaaacagc agggggacaa aagcatacac ttgctacagc aggctataat      1080
     ggtttctttg tactgacaaa gggtggttgt aaaacagaag ctgacgtaga agctgcatta      1140
     catttcctag ataagatgaa tgatgatgag atgcaaattc tttcttccta cggtcttaag      1200
     gatatccact attccttaga cgaaaacaat gttttcactg atattaaggg tgataataag      1260
     gacacattac ttcttgatta tgaggcattg aatcagaccg tagcttatat tccaaccaat      1320
     acgattacag gaattaagat accgactaca gaaagacagg acattcaagc agaattatat      1380
     atccaaaatg aaaaaaatgt agtattcaat cctgctgctg ctttgatcat aaactctgaa      1440
     acatatacct taaacggtgc aaaccttgat caaattatca atgatgcaag aacacagtac      1500
     atcgttggtg agattaataa ggatggatta aaggcagctt ggaatctttg ggcatccacc      1560
     ggtggtagtg atgttattaa agaagtgaat gatgcctatg caaagacaaa ataa            1614
//

If you have problems or comments...

PBIL Back to PBIL home page